Property Summary

NCBI Gene PubMed Count 79
PubMed Score 104.28
PubTator Score 125.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.210 7.7e-04
ovarian cancer -1.200 4.9e-04
primary Sjogren syndrome 1.100 3.2e-03
psoriasis -1.100 1.3e-02

Gene RIF (65)

AA Sequence

MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNK      1 - 70
LLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVE     71 - 140
DTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVE    141 - 210
VPA                                                                       211 - 213
//

Text Mined References (82)

PMID Year Title