Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.32
PubTator Score 4.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 3.45829572707686E-7
medulloblastoma, large-cell 6234 2.09064029826001E-6
glioblastoma 5572 2.18111333850899E-6
cystic fibrosis 1670 2.58004440348294E-5
pediatric high grade glioma 2712 2.48856054574578E-4
interstitial cystitis 2299 0.00143388619600609
osteosarcoma 7933 0.00164267587149923
ovarian cancer 8492 0.00199592774468983
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0119357238169837
inflammatory breast cancer 404 0.0160713528761262
primitive neuroectodermal tumor 3031 0.0400100659582931
acute myeloid leukemia 785 0.0462791437765916
Disease Target Count Z-score Confidence
Amebiasis 22 3.517 1.8
Sezary's disease 11 3.059 1.5

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.653 0.002
cystic fibrosis 1.633 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.100 0.040
pancreatic ductal adenocarcinoma liver m... -1.747 0.012
tuberculosis 1.600 0.000
interstitial cystitis -1.300 0.001
pediatric high grade glioma -1.100 0.000
inflammatory breast cancer -1.100 0.016
acute myeloid leukemia -1.100 0.046
ovarian cancer 1.900 0.002

Synonym

Accession Q9NVV5 B4DPX2 C9J569 Q5T2H2 Q6N047 Q7Z378 Q8TB14 Q9Y3A9 Q9Y5B4 AIG-1
Symbols AIG-1
dJ95L4.1

Gene

  Ortholog (11)

Gene RIF (3)

PMID Text
27018888 These results indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism.
21622095 identified a novel Pirh2-interacting protein, AIG1, by yeast two-hybrid screening and confirmed its interaction with p53 both in vitro and in vivo
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGS      1 - 70
GNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPF     71 - 140
ILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFL    141 - 210
YLLGEVLNNYIWDTQKKPPSWQDMKIKFMYLGPSS                                       211 - 245
//

Text Mined References (16)

PMID Year Title
27018888 2016 AIG1 and ADTRP are atypical integral membrane hydrolases that degrade bioactive FAHFAs.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21622095 2011 AIG1 is a novel Pirh2-interacting protein that activates the NFAT signaling pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...