Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.52
PubTator Score 4.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.100 4.6e-02
cystic fibrosis 1.633 2.6e-05
glioblastoma -1.100 3.2e-03
inflammatory breast cancer -1.100 1.6e-02
interstitial cystitis -1.300 1.4e-03
medulloblastoma, large-cell -2.500 2.1e-06
osteosarcoma -1.653 1.6e-03
ovarian cancer 1.900 2.0e-03
pancreatic ductal adenocarcinoma liver m... -1.747 1.2e-02
pediatric high grade glioma -1.100 2.5e-04
primitive neuroectodermal tumor -1.100 4.0e-02
tuberculosis 1.600 3.5e-07

Gene RIF (3)

AA Sequence

MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGS      1 - 70
GNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPF     71 - 140
ILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFL    141 - 210
YLLGEVLNNYIWDTQKKPPSWQDMKIKFMYLGPSS                                       211 - 245
//

Text Mined References (16)

PMID Year Title