Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.32
PubTator Score 4.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.653 0.002
cystic fibrosis 1.633 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.100 0.040
pancreatic ductal adenocarcinoma liver m... -1.747 0.012
tuberculosis 1.600 0.000
interstitial cystitis -1.300 0.001
pediatric high grade glioma -1.100 0.000
inflammatory breast cancer -1.100 0.016
acute myeloid leukemia -1.100 0.046
ovarian cancer 1.900 0.002

Gene RIF (3)

PMID Text
27018888 These results indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism.
21622095 identified a novel Pirh2-interacting protein, AIG1, by yeast two-hybrid screening and confirmed its interaction with p53 both in vitro and in vivo
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGS      1 - 70
GNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPF     71 - 140
ILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFL    141 - 210
YLLGEVLNNYIWDTQKKPPSWQDMKIKFMYLGPSS                                       211 - 245
//

Publication (16)

PMID Year Title
27018888 2016 AIG1 and ADTRP are atypical integral membrane hydrolases that degrade bioactive FAHFAs.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21622095 2011 AIG1 is a novel Pirh2-interacting protein that activates the NFAT signaling pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...