Property Summary

NCBI Gene PubMed Count 28
PubMed Score 23.96
PubTator Score 19.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
juvenile dermatomyositis 1.113 1.1e-08
lung cancer 1.300 1.4e-03
malignant mesothelioma 1.600 3.7e-07
osteosarcoma 1.283 2.2e-03
ovarian cancer 1.300 1.7e-02
psoriasis 1.100 6.2e-04
sonic hedgehog group medulloblastoma 1.100 1.4e-03

Gene RIF (12)

AA Sequence

MAVPGVGLLTRLNLCARRRTRVQRPIVRLLSCPGTVAKDLRRDEQPSGSVETGFEDKIPKRRFSEMQNER      1 - 70
REQAQRTVLIHCPEKISENKFLKYLSQFGPINNHFFYESFGLYAVVEFCQKESIGSLQNGTHTPSTAMET     71 - 140
AIPFRSRFFNLKLKNQTSERSRVRSSNQLPRSNKQLFELLCYAESIDDQLNTLLKEFQLTEENTKLRYLT    141 - 210
CSLIEDMAAAYFPDCIVRPFGSSVNTFGKLGCDLDMFLDLDETRNLSAHKISGNFLMEFQVKNVPSERIA    211 - 280
TQKILSVLGECLDHFGPGCVGVQKILNARCPLVRFSHQASGFQCDLTTNNRIALTSSELLYIYGALDSRV    281 - 350
RALVFSVRCWARAHSLTSSIPGAWITNFSLTMMVIFFLQRRSPPILPTLDSLKTLADAEDKCVIEGNNCT    351 - 420
FVRDLSRIKPSQNTETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNV    421 - 490
SQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPSAPNRKSFTKKKSNKFAIETVKNLLES    491 - 560
LKGNRTENFTKTSGKRTISTQT                                                    561 - 582
//

Text Mined References (32)

PMID Year Title