Property Summary

NCBI Gene PubMed Count 18
PubMed Score 24.39
PubTator Score 12.75

Knowledge Summary

Patent (694)

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis -1.236 7.4e-03
Astrocytoma, Pilocytic 1.100 1.0e-05
atypical teratoid / rhabdoid tumor 1.200 1.1e-02
cystic fibrosis 1.242 1.2e-04
ependymoma 1.400 3.9e-07
glioblastoma 1.100 1.9e-05
group 3 medulloblastoma 1.200 1.2e-02
hereditary spastic paraplegia -1.252 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.300 9.6e-03
lung carcinoma 1.200 1.4e-12
medulloblastoma, large-cell 2.000 7.3e-04
nasopharyngeal carcinoma 1.500 1.2e-03
osteosarcoma 2.451 3.7e-03
pancreatic ductal adenocarcinoma liver m... -1.101 1.3e-02

Gene RIF (7)

AA Sequence

MDSPWDELALAFSRTSMFPFFDIAHYLVSVMAVKRQPGAAALAWKNPISSWFTAMLHCFGGGILSCLLLA      1 - 70
EPPLKFLANHTNILLASSIWYITFFCPHDLVSQGYSYLPVQLLASGMKEVTRTWKIVGGVTHANSYYKNG     71 - 140
WIVMIAIGWARGAGGTIITNFERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQHLAISKHNLMF    141 - 210
LYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASD    211 - 280
NVKKKHTKKNE                                                               281 - 291
//

Text Mined References (24)

PMID Year Title