Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.45
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.200 7.4e-03
atypical teratoid / rhabdoid tumor -1.600 2.4e-04
Breast cancer 2.400 2.7e-02
colon cancer 1.600 1.5e-02
Gaucher disease type 1 1.100 1.8e-02
glioblastoma -1.200 1.2e-02
juvenile dermatomyositis 1.255 5.3e-10
medulloblastoma, large-cell -1.300 1.8e-03
osteosarcoma 1.146 8.9e-04
ovarian cancer -1.100 6.6e-06
Pick disease -1.100 8.9e-05
psoriasis -2.500 4.1e-05
ulcerative colitis 1.100 2.2e-05

Gene RIF (4)

AA Sequence

MSNRNNNKLPSNLPQLQNLIKRDPPAYIEEFLQQYNHYKSNVEIFKLQPNKPSKELAELVMFMAQISHCY      1 - 70
PEYLSNFPQEVKDLLSCNHTVLDPDLRMTFCKALILLRNKNLINPSSLLELFFELFRCHDKLLRKTLYTH     71 - 140
IVTDIKNINAKHKNNKVNVVLQNFMYTMLRDSNATAAKMSLDVMIELYRRNIWNDAKTVNVITTACFSKV    141 - 210
TKILVAALTFFLGKDEDEKQDSDSESEDDGPTARDLLVQYATGKKSSKNKKKLEKAMKVLKKQKKKKKPE    211 - 280
VFNFSAIHLIHDPQDFAEKLLKQLECCKERFEVKMMLMNLISRLVGIHELFLFNFYPFLQRFLQPHQREV    281 - 350
TKILLFAAQASHHLVPPEIIQSLLMTVANNFVTDKNSGEVMTVGINAIKEITARCPLAMTEELLQDLAQY    351 - 420
KTHKDKNVMMSARTLIHLFRTLNPQMLQKKFRGKPTEASIEARVQEYGELDAKDYIPGAEVLEVEKEENA    421 - 490
ENDEDGWESTSLSEEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIR    491 - 560
MAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRK    561 - 630
KTKTNPFSSSTNKEKKKQKNFMMMRYSQNVRSKNKRSFREKQLALRDALLKKRKRMK                 631 - 687
//

Text Mined References (28)

PMID Year Title