Property Summary

NCBI Gene PubMed Count 11
PubMed Score 145.90
PubTator Score 70.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.0e-06
Pick disease 1894 4.6e-06
osteosarcoma 7950 1.4e-05
tuberculosis 2010 4.8e-05
Multiple myeloma 1332 2.4e-03
lung cancer 4740 2.6e-03
astrocytoma 1146 5.5e-03
non primary Sjogren syndrome sicca 891 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Plasmacytoma 7 4.789 2.4

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.400 5.5e-03
lung cancer 1.100 2.6e-03
Multiple myeloma 1.064 2.4e-03
non primary Sjogren syndrome sicca 1.200 3.6e-02
osteosarcoma -1.135 1.4e-05
ovarian cancer 2.100 4.0e-06
Pick disease -1.300 4.6e-06
tuberculosis -1.100 4.8e-05

Gene RIF (2)

AA Sequence

MANEEDDPVVQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEMAIDTLNPNYC      1 - 70
RSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFS     71 - 140
YLDKADAKHREREAANEAGDSSQDEAEDDVKQITVRFSRPESEQARQRRVQSYEFLQKKHAEEPWVHLHY    141 - 210
YGLRDSRSEHERQYLLCPGSSGVENTELVKSPSEYLMMLMPPSQEEEKDKPVAPSNVLSMAQLRTLPLAD    211 - 280
QIKILMKNVKVMPFANLMSLLGPSIDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGVPAEVLC    281 - 350
RGRDFVMWKFTQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQH    351 - 420
MLWTGIQAKLEKVYNLVKETMPKKPDAQSGPAGLVCGDQRIQVAKTKAQQNHALLERELQRRKEQLRVPA    421 - 490
VPPGVRIKEEPVSEEGEEDEEQEAEEEPMDTSPSGLHSKLANGLPLGRAAGTDSFNGHPPQGCASTPVAR    491 - 560
ELKAFVEATFQRQFVLTLSELKRLFNLHLASLPPGHTLFSGISDRMLQDTVLAAGCKQILVPFPPQTAAS    561 - 630
PDEQKVFALWESGDMSDQHRQVLLEIFSKNYRVRRNMIQSRLTQECGEDLSKQEVDKVLKDCCVSYGGMW    631 - 700
YLKGTVQS                                                                  701 - 708
//

Text Mined References (27)

PMID Year Title