Property Summary

Ligand Count 1
NCBI Gene PubMed Count 22
PubMed Score 90.70
PubTator Score 50.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 5.7e-04
lung carcinoma 1.200 5.0e-24
osteosarcoma -1.855 1.4e-07
ovarian cancer 1.200 1.4e-03
pancreatic ductal adenocarcinoma liver m... -2.125 1.0e-03
primitive neuroectodermal tumor -1.100 3.7e-03
psoriasis -1.800 2.6e-04

Gene RIF (11)

AA Sequence

MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAV      1 - 70
QCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQV     71 - 140
RVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYV    141 - 210
LYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP                       211 - 261
//

Text Mined References (28)

PMID Year Title