Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.72
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.300 8.5e-04
lung cancer 1.100 1.8e-03
non primary Sjogren syndrome sicca 1.100 3.4e-02

Gene RIF (4)

AA Sequence

MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQC      1 - 70
PICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVV     71 - 140
PKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH                  141 - 196
//

Text Mined References (18)

PMID Year Title