Property Summary

NCBI Gene PubMed Count 8
PubMed Score 17.08
PubTator Score 9.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Kartagener Syndrome 32
Disease Target Count P-value
lung adenocarcinoma 2714 2.67367944628295E-6
lung cancer 4473 1.5296452695302E-4
posterior fossa group B ependymoma 1530 2.02631483132773E-4
medulloblastoma, large-cell 6234 0.00131233436643346
group 3 medulloblastoma 2254 0.00184604515566384
Disease Target Count Z-score Confidence
Situs Inversus 52 3.168 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 2.100 0.002
medulloblastoma, large-cell 1.100 0.001
lung cancer 1.900 0.000
posterior fossa group B ependymoma 1.300 0.000
lung adenocarcinoma 1.374 0.000

Synonym

Accession Q9NVR5 B9WS54 C0JAP7 Q86TR1 Q86TY8 Q969Z5
Symbols KTU
PF13
CILD10
C14orf104

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
19052621 Ktu/PF13 is one of the long-sought proteins involved in pre-assembly of dynein arm complexes in the cytoplasm before intraflagellar transport loads them for the ciliary compartment.

AA Sequence

MAKAAASSSLEDLDLSGEEVQRLTSAFQDPEFRRMFSQYAEELTDPENRRRYEAEITALERERGVEVRFV      1 - 70
HPEPGHVLRTSLDGARRCFVNVCSNALVGAPSSRPGSGGDRGAAPGSHWSLPYSLAPGREYAGRSSSRYM     71 - 140
VYDVVFHPDALALARRHEGFRQMLDATALEAVEKQFGVKLDRRNAKTLKAKYKGTPEAAVLRTPLPGVIP    141 - 210
ARPDGEPKGPLPDFPYPYQYPAAPGPRAPSPPEAALQPAPTEPRYSVVQRHHVDLQDYRCSRDSAPSPVP    211 - 280
HELVITIELPLLRSAEQAALEVTRKLLCLDSRKPDYRLRLSLPYPVDDGRGKAQFNKARRQLVVTLPVVL    281 - 350
PAARREPAVAVAAAAPEESADRSGTDGQACASAREGEAGPARSRAEDGGHDTCVAGAAGSGVTTLGDPEV    351 - 420
APPPAAAGEERVPKPGEQDLSRHAGSPPGSVEEPSPGGENSPGGGGSPCLSSRSLAWGSSAGRESARGDS    421 - 490
SVETREESEGTGGQRSACAMGGPGTKSGEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLR    491 - 560
FSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLEERLFVNEEN    561 - 630
VNEFLEEVLSSPFKQSMSLTPPLIEVLQVTDNKIQINAKLQECSNSDQLQGKEERVNEESHLTEKEYIEH    631 - 700
CNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKDNL    701 - 770
NESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIKDHVTNCAFSFQNSLLYDLD       771 - 837
//

Text Mined References (13)

PMID Year Title
25186273 2014 Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia.
23872636 2013 DYX1C1 is required for axonemal dynein assembly and ciliary motility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19052621 2008 Ktu/PF13 is required for cytoplasmic pre-assembly of axonemal dyneins.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...