Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.35
PubTator Score 1.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.81957391535998E-28
osteosarcoma 7933 3.35561284199244E-5
medulloblastoma, large-cell 6234 2.52000567232478E-4
group 4 medulloblastoma 1875 0.00232669063437041
Breast cancer 3099 0.0248609387717636

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.200 0.000
medulloblastoma, large-cell 1.100 0.000
Breast cancer 2.900 0.025
group 4 medulloblastoma 1.100 0.002
lung carcinoma 1.100 0.000

Synonym

Accession Q9NVR0
Symbols

Gene

PDB

4AP2   4APF   3I3N  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
23349464 analysis of crystal structures of the BTB-BACK domains of KLHL11 both alone and in complex with Cul3

AA Sequence

MAAAAVAAAAAAAAAASLQVLEMESMETAAAGSAGLAAEVRGSGTVDFGPGPGISAMEASGGDPGPEAED      1 - 70
FECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEM     71 - 140
RKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHS    141 - 210
LAHMYTLSQLALKAADMIRRNFHKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEE    211 - 280
RERYFEELFKLLRLSQMKPTYLTRHVKPERLVANNEVCVKLVADAVERHALRAENIQSGTCQHPTSHVSL    281 - 350
LPRYGQNMDVIMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAVTESYVYVAGSMEPGFA    351 - 420
KTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELDKWHNLESAPKI    421 - 490
LRDVKALAIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVESLPLIDNYCFFQMSVVNSNFYQ    491 - 560
TASCCPKSYCLENEEAVRKIASQVSDEILESLPPEVLSIEGAAICYYKDDVFIIGGWKNSDDIDKQYRKE    561 - 630
AYRYCAERKRWMLLPPMPQPRCRATACHVRIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRR    631 - 700
VPSSQIEC                                                                  701 - 708
//

Text Mined References (6)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23349464 2013 Structural basis for Cul3 protein assembly with the BTB-Kelch family of E3 ubiquitin ligases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.