Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.58
PubTator Score 1.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.8e-28
osteosarcoma 7950 3.4e-05
medulloblastoma, large-cell 6241 2.5e-04
group 4 medulloblastoma 1855 2.3e-03
Breast cancer 3578 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.900 2.5e-02
group 4 medulloblastoma 1.100 2.3e-03
lung carcinoma 1.100 1.8e-28
medulloblastoma, large-cell 1.100 2.5e-04
osteosarcoma 1.200 3.4e-05

Gene RIF (1)

AA Sequence

MAAAAVAAAAAAAAAASLQVLEMESMETAAAGSAGLAAEVRGSGTVDFGPGPGISAMEASGGDPGPEAED      1 - 70
FECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEM     71 - 140
RKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHS    141 - 210
LAHMYTLSQLALKAADMIRRNFHKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEE    211 - 280
RERYFEELFKLLRLSQMKPTYLTRHVKPERLVANNEVCVKLVADAVERHALRAENIQSGTCQHPTSHVSL    281 - 350
LPRYGQNMDVIMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAVTESYVYVAGSMEPGFA    351 - 420
KTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELDKWHNLESAPKI    421 - 490
LRDVKALAIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVESLPLIDNYCFFQMSVVNSNFYQ    491 - 560
TASCCPKSYCLENEEAVRKIASQVSDEILESLPPEVLSIEGAAICYYKDDVFIIGGWKNSDDIDKQYRKE    561 - 630
AYRYCAERKRWMLLPPMPQPRCRATACHVRIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRR    631 - 700
VPSSQIEC                                                                  701 - 708
//

Text Mined References (6)

PMID Year Title