Property Summary

NCBI Gene PubMed Count 18
PubMed Score 32.56
PubTator Score 21.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 3.4e-04
ependymoma 1.200 4.0e-07
intraductal papillary-mucinous carcinoma... -1.100 1.2e-02
lung cancer 1.600 2.9e-03
malignant mesothelioma -2.700 3.0e-08
ovarian cancer 2.000 1.0e-03
progressive supranuclear palsy -1.200 1.9e-02
psoriasis 1.200 7.9e-04

Gene RIF (10)

AA Sequence

MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI      1 - 70
SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET     71 - 140
HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS                                   141 - 179
//

Text Mined References (21)

PMID Year Title