Property Summary

NCBI Gene PubMed Count 15
PubMed Score 27.56
PubTator Score 21.46

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.43250248658715E-8
malignant mesothelioma 3163 2.9654337566571E-8
pilocytic astrocytoma 3086 3.37870450284017E-4
psoriasis 6685 7.86670476853667E-4
ovarian cancer 8492 0.00102577181533863
lung cancer 4473 0.0028975449099917
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.011841110852685
progressive supranuclear palsy 674 0.018636301759317
Disease Target Count Z-score Confidence
Food allergy 8 3.964 2.0


  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
psoriasis 1.200 0.001
posterior fossa group B ependymoma 1.700 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.012
lung cancer 1.600 0.003
pilocytic astrocytoma 1.100 0.000
progressive supranuclear palsy -1.200 0.019
ovarian cancer 2.000 0.001


Accession Q9NVQ4 Q6IAN2
Symbols FAIM1



2KW1   3MX7  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (7)

23138182 FAIM modulates IGF-1-induced Akt activation and IRF4 expression and has a role in multiple myeloma cell survival
20693673 FAIM (1-90) was crystallized and diffracted to a resolution of 2.5 A; the crystal belonged to space group P3(1), with unit-cell parameters a=b=58.02, c=71.11 A, alpha=beta=90, gamma=120 degrees.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19592656 FAIM acts to specifically enhance CD40 signaling for NF-kappaB activation, IRF-4 expression, and BCL-6 down-regulation in vitro, but has no effect on its own
17942717 Expression of the long form of Fas apoptotic inhibitory molecule (FAIML) results in the protection of neurons from the cytotoxic actions of death ligands.
17912957 Human keratinocytes were transfected with either Flip, Faim, or Lifeguard (LFG). Our results suggest that heterotopic expression of antiapoptotic proteins can induce the resistance of keratinocytes to a major mechanism of rejection.

AA Sequence

HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS                                   141 - 179

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23138182 2013 Fas apoptosis inhibitory molecule is upregulated by IGF-1 signaling and modulates Akt activation and IRF4 expression in multiple myeloma.
21269460 2011 Initial characterization of the human central proteome.
20693673 2010 Crystallization and preliminary X-ray crystallographic studies of human FAIM protein.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19592656 2009 Fas apoptosis inhibitory molecule enhances CD40 signaling in B cells and augments the plasma cell compartment.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17942717 2007 The long form of Fas apoptotic inhibitory molecule is expressed specifically in neurons and protects them against death receptor-triggered apoptosis.
17912957 2007 Inhibition of apoptosis by expression of antiapoptotic proteins in recombinant human keratinocytes.