Property Summary

NCBI Gene PubMed Count 35
PubMed Score 10.55
PubTator Score 13.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.918 1.7e-04
adult high grade glioma 1.600 2.3e-05
atypical teratoid / rhabdoid tumor 2.200 1.9e-09
Breast cancer 1.300 8.8e-12
Endometriosis 1.093 1.1e-02
glioblastoma 1.500 1.4e-07
group 3 medulloblastoma 1.600 2.5e-04
lung cancer 1.200 2.8e-03
malignant mesothelioma 2.300 7.7e-08
medulloblastoma, large-cell 2.000 3.2e-06
non-small cell lung cancer 1.764 2.0e-24
osteosarcoma -1.674 1.2e-03
ovarian cancer 1.900 4.8e-12
primitive neuroectodermal tumor 1.600 5.7e-05
psoriasis 1.400 2.6e-68

 GO Function (1)

Gene RIF (17)

AA Sequence

MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRH      1 - 70
MFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL     71 - 140
ASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI            141 - 202
//

Text Mined References (42)

PMID Year Title