Property Summary

NCBI Gene PubMed Count 30
Grant Count 1
Funding $125,621.25
PubMed Score 10.37
PubTator Score 13.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
osteosarcoma -1.674 0.001
glioblastoma 2.200 0.000
medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 2.200 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.600 0.000
adrenocortical carcinoma 1.918 0.000
non-small cell lung cancer 1.764 0.000
lung cancer 1.200 0.003
pediatric high grade glioma 1.800 0.000
Endometriosis 1.093 0.011
non-inflammatory breast cancer 1.500 0.001
ovarian cancer 1.900 0.000
psoriasis 1.400 0.000

Synonym

Accession Q9NVP2 Q53G51 Q9NVZ0
Symbols CIA-II

Gene

 Grant Application (1)

PDB

5BNX   5BO0  

Gene RIF (16)

PMID Text
24598821 Data indicate Tousled-like kinases (TLK1) phosphorylation has an impact on cell cycle proteins Asf1a and Asf1b function.
24413054 Co-depletion of the histone chaperones ASF1a and ASF1b in human cells induces all hallmarks of alternative lengthening of telomeres in both primary and cancer cells.
23178455 study of the interaction of the histone H3-H4 complex with the RbAp48 and their exchange with a second histone chaperone, anti-silencing function protein 1 (ASF1); exchange of histones H3-H4 between these two histone chaperones has a central role in the assembly of new nucleosomes
23100276 Data indicate that miR-214 down-regulated the expression of PSMD10 (gankyrin) and ASF1B, and gankyrin inhibition induced an increase of P53 mRNA levels.
21179005 Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20227376 Identify marks on histones H3-H4 bound to Asf1 and changes induced upon replication stress.
20133788 Data show that Asf1b localizes with HCF-1 in viral replication foci and depletion of Asf1b results in significantly reduced viral DNA accumulation.
20016786 ASF1 cellular levels are tightly controlled by distinct pathways and provide a molecular mechanism for post-translational regulation of dASF1 and hASF1a by TLK kinases.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRH      1 - 70
MFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL     71 - 140
ASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI            141 - 202
//

Text Mined References (38)

PMID Year Title
24616510 2014 Binding of the histone chaperone ASF1 to the CBP bromodomain promotes histone acetylation.
24598821 2014 Tousled-like kinases phosphorylate Asf1 to promote histone supply during DNA replication.
24413054 2014 Rapid induction of alternative lengthening of telomeres by depletion of the histone chaperone ASF1.
23178455 2013 Structural plasticity of histones H3-H4 facilitates their allosteric exchange between RbAp48 and ASF1.
23100276 2013 Restoration of microRNA-214 expression reduces growth of myeloma cells through positive regulation of P53 and inhibition of DNA replication.
22407294 2012 Codanin-1, mutated in the anaemic disease CDAI, regulates Asf1 function in S-phase histone supply.
21269460 2011 Initial characterization of the human central proteome.
21179005 2011 Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer.
21113133 2010 RNAi-based screening identifies the Mms22L-Nfkbil2 complex as a novel regulator of DNA replication in human cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...