Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.74
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis and chronic rhinosinusit... 1.344 2.7e-03
group 3 medulloblastoma 1.100 7.8e-04
malignant mesothelioma 2.300 3.1e-08
non-small cell lung cancer 1.432 2.9e-13
osteosarcoma 3.311 2.6e-06
Pick disease 1.400 5.1e-05
psoriasis 1.900 3.6e-05

Gene RIF (7)

AA Sequence

MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPNDHANREAELKKKWVEEMREK      1 - 70
QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEATRKAYYKEFRKVVEYSDVILE     71 - 140
VLDARDPLGCRCFQMEEAVLRAQGNKKLVLVLNKIDLVPKEVVEKWLDYLRNELPTVAFKASTQHQVKNL    141 - 210
NRCSVPVDQASESLLKSKACFGAENLMRVLGNYCRLGEVRTHIRVGVVGLPNVGKSSLINSLKRSRACSV    211 - 280
GAVPGITKFMQEVYLDKFIRLLDAPGIVPGPNSEVGTILRNCVHVQKLADPVTPVETILQRCNLEEISNY    281 - 350
YGVSGFQTTEHFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKE    351 - 420
MTEVFDIEDTEQANEDTMECLATGESDELLGDTDPLEMEIKLLHSPMTKIADAIENKTTVYKIGDLTGYC    421 - 490
TNPNRHQMGWAKRNVDHRPKSNSMVDVCSVDRRSVLQRIMETDPLQQGQALASALKNKKKMQKRADKIAS    491 - 560
KLSDSMMSALDLSGNADDGVGD                                                    561 - 582
//

Text Mined References (20)

PMID Year Title