Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.74
PubTator Score 5.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
psoriasis 1.900 0.000
osteosarcoma 3.311 0.000
non-small cell lung cancer 1.432 0.000
group 3 medulloblastoma 1.100 0.001
Pick disease 1.400 0.000
cystic fibrosis and chronic rhinosinusit... 1.344 0.003

Synonym

Accession Q9NVN8
Symbols GNL3B

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
26274615 the present study provides evidence that GNL3L is exported from the nucleus in CRM1 dependent manner and the nuclear localization of GNL3L is important to promote 'S' phase progression during cell proliferation.
24610951 GNL3L depletion impairs ribosome production without inducing appreciable DNA damage. During evolution, GNL3L retained the role of the ancestral gene in ribosome biosynthesis, whereas the paralogous nucleostemin acquired a novel genome-protective function.
21132010 GNL3L bound MDM2 in vivo, stabilizing MDM2 and preventing its ubiquitylation. GNL3L depletion upregulated specific p53 targets (Bax, 14-3-3sigma and p21).
21063916 differences in the relative nucleostemin protein and mRNA levels may reflect the degree of proliferation of mesnchymal stem cells and can be used to characterize in vitro expansion capabilities
17034816 GNL3L is composed of distinct modules, each of which plays a specific role in molecular interactions for its nucleolar retention and subsequent function(s) within the nucleolus
16251348 analysis uncovers an important role for Grn1p/GNL3L within this unique group of nucleolar GTPases

AA Sequence

MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPNDHANREAELKKKWVEEMREK      1 - 70
QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEATRKAYYKEFRKVVEYSDVILE     71 - 140
VLDARDPLGCRCFQMEEAVLRAQGNKKLVLVLNKIDLVPKEVVEKWLDYLRNELPTVAFKASTQHQVKNL    141 - 210
NRCSVPVDQASESLLKSKACFGAENLMRVLGNYCRLGEVRTHIRVGVVGLPNVGKSSLINSLKRSRACSV    211 - 280
GAVPGITKFMQEVYLDKFIRLLDAPGIVPGPNSEVGTILRNCVHVQKLADPVTPVETILQRCNLEEISNY    281 - 350
YGVSGFQTTEHFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKE    351 - 420
MTEVFDIEDTEQANEDTMECLATGESDELLGDTDPLEMEIKLLHSPMTKIADAIENKTTVYKIGDLTGYC    421 - 490
TNPNRHQMGWAKRNVDHRPKSNSMVDVCSVDRRSVLQRIMETDPLQQGQALASALKNKKKMQKRADKIAS    491 - 560
KLSDSMMSALDLSGNADDGVGD                                                    561 - 582
//

Text Mined References (19)

PMID Year Title
26274615 2015 GNL3L Is a Nucleo-Cytoplasmic Shuttling Protein: Role in Cell Cycle Regulation.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24610951 2014 Nucleostemin and GNL3L exercise distinct functions in genome protection and ribosome synthesis, respectively.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22641345 2012 Nucleostemin prevents telomere damage by promoting PML-IV recruitment to SUMOylated TRF1.
21132010 2011 GNL3L depletion destabilizes MDM2 and induces p53-dependent G2/M arrest.
21063916 2011 Continual expression throughout the cell cycle and downregulation upon adipogenic differentiation makes nucleostemin a vital human MSC proliferation marker.
19946888 2010 Defining the membrane proteome of NK cells.
19487455 2009 GNL3L stabilizes the TRF1 complex and promotes mitotic transition.
More...