Property Summary

NCBI Gene PubMed Count 18
Grant Count 8
R01 Count 8
Funding $779,593.51
PubMed Score 20.37
PubTator Score 16.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.300 0.000

Gene RIF (9)

PMID Text
25605249 Upregulation of PRMT7 in breast cancer may have a significant role in promoting cell invasion through the regulation of MMP9.
25294873 Data indicate that two acidic residues within the double E loop, Asp-147 and Glu-149, confer specificity to protein arginine methyltransferase 7 (PRMT7.
25136067 results define PRMT7 as an inducer of breast cancer metastasis and present the opportunity for applying PRMT7-targeted therapeutics to treat highly invasive breast cancers
22761421 reducing expression of individual PRMT7 target DNA repair genes showed that only the catalytic subunit of DNA polymerase, POLD1, was able to resensitize PRMT7 knock-down cells to DNA-damaging agents.
22241471 Human protein arginine methyltransferase 7 (PRMT7) is a type III enzyme forming omega-NG-monomethylated arginine residues.
22231400 Here the authors report that H3R2 is also symmetrically dimethylated (H3R2me2s) by PRMT5 and PRMT7 and present in euchromatic regions.
17709427 that in human cells, PRMT5 and PRMT7 are required for Sm protein sDMA modification, and that Sm protein symmetric dimethylarginine modification is required for snRNP biogenesis in human cells.
15494416 PRMT7 (like PRMT5) is a Type II methyltransferase capable of producing symmetric dimethylarginine modifications in proteins.
15044439 both domains are required for functionality

AA Sequence

MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQGIRAAVSRVKDRGQKALVLD      1 - 70
IGTGTGLLSMMAVTAGADFCYAIEVFKPMADAAVKIVEKNGFSDKIKVINKHSTEVTVGPEGDMPCRANI     71 - 140
LVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFPIHVQTSLGEQVI    141 - 210
VPPVDVESCPGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQVSSSAACHSRRFEPLTSGRAQVVLS    211 - 280
WWDIEMDPEGKIKCTMAPFWAHSDPEEMQWRDHWMQCVYFLPQEEPVVQGSALYLVAHHDDYCVWYSLQR    281 - 350
TSPEKNERVRQMRPVCDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDSVCLCVSDGSLLSVLAHH    351 - 420
LGVEQVFTVESSAASHKLLRKIFKANHLEDKINIIEKRPELLTNEDLQGRKVSLLLGEPFFTTSLLPWHN    421 - 490
LYFWYVRTAVDQHLGPGAMVMPQAASLHAVVVEFRDLWRIRSPCGDCEGFDVHIMDDMIKRALDFRESRE    491 - 560
AEPHPLWEYPCRSLSEPWQILTFDFQQPVPLQPLCAEGTVELRRPGQSHAAVLWMEYHLTPECTLSTGLL    561 - 630
EPADPEGGCCWNPHCKQAVYFFSPAPDPRALLGGPRTVSYAVEFHPDTGDIIMEFRHADTPD            631 - 692
//

Text Mined References (22)

PMID Year Title
26429889 2015 A human laterality disorder caused by a homozygous deleterious mutation in MMP21.
25605249 2015 Protein arginine methyltransferase 7 promotes breast cancer cell invasion through the induction of MMP9 expression.
25294873 2014 Substrate specificity of human protein arginine methyltransferase 7 (PRMT7): the importance of acidic residues in the double E loop.
25136067 2014 PRMT7 induces epithelial-to-mesenchymal transition and promotes metastasis in breast cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22761421 2012 Protein arginine methyltransferase 7 regulates cellular response to DNA damage by methylating promoter histones H2A and H4 of the polymerase ? catalytic subunit gene, POLD1.
22241471 2012 Human protein arginine methyltransferase 7 (PRMT7) is a type III enzyme forming ?-NG-monomethylated arginine residues.
22231400 2012 Symmetric dimethylation of H3R2 is a newly identified histone mark that supports euchromatin maintenance.
20700443 2010 Genome-wide association studies of serum magnesium, potassium, and sodium concentrations identify six Loci influencing serum magnesium levels.
19110445 2009 Accurate localization and relative quantification of arginine methylation using nanoflow liquid chromatography coupled to electron transfer dissociation and orbitrap mass spectrometry.
More...