Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 6.3e-05
nephrosclerosis 333 1.1e-04
ovarian cancer 8520 1.1e-03

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis 1.043 1.1e-04
osteosarcoma 1.316 6.3e-05
ovarian cancer 1.100 1.1e-03

Synonym

Accession Q9NVM1 D3DPS7
Symbols C1orf78
FAM176B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRS      1 - 70
STLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVFTSAEELERAQRLEERERILREIWRTGQ     71 - 140
PDLLGTGTLGPSPTATGTLGRMHYY                                                 141 - 165
//

Text Mined References (8)

PMID Year Title