Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.95
PubTator Score 12.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Myeloproliferative disease 7
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.17351206034442E-6
medulloblastoma, large-cell 6234 1.31723917521465E-5
glioblastoma 5572 2.34855518915176E-5
medulloblastoma 1524 2.91621893882313E-5
interstitial cystitis 2299 4.97488554319323E-5
osteosarcoma 7933 1.13278111037549E-4
ovarian cancer 8492 2.11268924307347E-4
primitive neuroectodermal tumor 3031 2.40006044342575E-4
acute quadriplegic myopathy 1157 7.91186691756259E-4
Pick disease 1893 8.5900877743028E-4
primary pancreatic ductal adenocarcinoma 1271 0.00248660916680066
primary Sjogren syndrome 789 0.00281391767358214
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00324712015947198
nasopharyngeal carcinoma 1056 0.00812312423141216
adult high grade glioma 2148 0.00866939534951646
sarcoidosis 368 0.00898111760406302
aldosterone-producing adenoma 664 0.0129246234800344
ependymoma 2514 0.0165043895064775
cystic fibrosis and chronic rhinosinusitis 213 0.0390517950983455
Alzheimer's disease 644 0.0491645416005132

Expression

Synonym

Accession Q9NVK5 Q6R955 Q8N5L7 Q9P034 Q9UFK8
Symbols WIT3.0
HSPC123-like

Gene

  Ortholog (11)

Gene RIF (5)

PMID Text
22880093 The patient with minor allele of ss518063493 may be associated with excessive atrophy of edentulous mandible whereas the patients with that of rs840869 are not associated in Korean population.
21283824 patients with the minor allele of rs840869 or rs859024 of FGFR1OP2 were associated with excessive atrophy of edentulous mandible
20734064 Observational study of gene-disease association. (HuGE Navigator)
19959814 FGFR1OP2/wit3.0 may regulate cell motility and stimulate wound closure.
15034873 FGFR1OP2 is a new FGFR1 fusion gene involving a chromosomes 12X8 translocation in a 8p11 myeloproliferative syndrome patient.

AA Sequence

MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHRPRSTLVMGIQ      1 - 70
QENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNK     71 - 140
SEGFFLDASRHILEAPQHGLERRHLEANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQE    141 - 210
NKGLREILQITRESFLNLRKDDASESTSLSALVTNSDLSLRKS                               211 - 253
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22880093 2012 Association between FGFR1OP2/wit3.0 polymorphisms and residual ridge resorption of mandible in Korean population.
21283824 2011 A genetic association study of single nucleotide polymorphisms in FGFR1OP2/wit3.0 and long-term atrophy of edentulous mandible.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19959814 2010 Small cytoskeleton-associated molecule, fibroblast growth factor receptor 1 oncogene partner 2/wound inducible transcript-3.0 (FGFR1OP2/wit3.0), facilitates fibroblast-driven wound closure.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17389761 2007 14-3-3 Integrates prosurvival signals mediated by the AKT and MAPK pathways in ZNF198-FGFR1-transformed hematopoietic cells.
16946300 2006 Phosphotyrosine profiling identifies the KG-1 cell line as a model for the study of FGFR1 fusions in acute myeloid leukemia.
More...