Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.54
PubTator Score 12.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.111 7.9e-04
adult high grade glioma -1.400 8.7e-03
aldosterone-producing adenoma -1.524 1.3e-02
Alzheimer's disease 1.100 4.9e-02
atypical teratoid / rhabdoid tumor -1.300 3.6e-05
cystic fibrosis and chronic rhinosinusit... -1.022 3.9e-02
ependymoma 1.500 1.7e-02
glioblastoma -1.800 2.3e-05
group 4 medulloblastoma -1.300 7.1e-04
interstitial cystitis 1.100 5.9e-04
intraductal papillary-mucinous adenoma (... 1.300 3.2e-03
medulloblastoma, large-cell -1.100 1.3e-03
nasopharyngeal carcinoma 1.100 8.1e-03
osteosarcoma 1.725 1.9e-03
ovarian cancer -2.000 2.1e-04
Pick disease 1.500 8.6e-04
primary pancreatic ductal adenocarcinoma 1.022 2.5e-03
primary Sjogren syndrome 1.100 2.8e-03
primitive neuroectodermal tumor -1.300 2.4e-04
sarcoidosis 1.300 9.0e-03

Gene RIF (5)

AA Sequence

MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHRPRSTLVMGIQ      1 - 70
QENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNK     71 - 140
SEGFFLDASRHILEAPQHGLERRHLEANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQE    141 - 210
NKGLREILQITRESFLNLRKDDASESTSLSALVTNSDLSLRKS                               211 - 253
//

Text Mined References (16)

PMID Year Title