Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
R01 Count 5
Funding $428,946.51
PubMed Score 10.01
PubTator Score 7.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.153 0.029
Multiple myeloma 1.648 0.003
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.273 0.014
tuberculosis -1.300 0.000
breast carcinoma 1.200 0.000
Pick disease -1.200 0.000
Breast cancer 1.100 0.000
invasive ductal carcinoma 1.200 0.000
ovarian cancer -1.600 0.000
pancreatic cancer 1.200 0.008
dermatomyositis 1.100 0.001

Gene RIF (8)

PMID Text
25908847 Arl8b regulates the association of the human HOPS complex with lysosomal membranes.
24088571 a small GTP-binding protein, ADP-ribosylation factor-like 8b (Arl8b), is identified as a critical factor required for NK cell-mediated cytotoxicity.
23166591 Expression of HIV-1 Tat upregulates the abundance of ADP-ribosylation factor-like 8B (ARL8B) in the nucleoli of Jurkat T-cells
21824248 The authors find that Arl8B is required for kinesin-1 recruitment to Salmonella-containing vacuoles, migration of the vacuoles to the cell periphery 24 h after infection and for cell-to-cell transfer of bacteria to neighbouring cells.
21802320 a critical regulator of cargo delivery to lysosomes
19398576 Data show that with MAK3 knockdown, p53 is stabilized and phosphorylated and there is a significant transcriptional activation of proapoptotic genes downstream of p53, and that localization of Arl8b is altered, suggesting that Arl8b is a Mak3 substrate.
16650381 Arl8b is involved in trafficking processes for lysosomes.
15331635 Results suggest that the novel GTPases Gie1 and Gie2 associate with microtubules, and might be involved in chromosome segregation.

AA Sequence

MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW      1 - 70
DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE     71 - 140
KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS                            141 - 186
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25908847 2015 The small GTPase Arl8b regulates assembly of the mammalian HOPS complex on lysosomes.
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24088571 2013 Arf-like GTPase Arl8b regulates lytic granule polarization and natural killer cell-mediated cytotoxicity.
22993228 2013 Novel genetic variants associated with lumbar disc degeneration in northern Europeans: a meta-analysis of 4600 subjects.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21824248 2011 Salmonella exploits Arl8B-directed kinesin activity to promote endosome tubulation and cell-to-cell transfer.
21802320 2011 Lysosomal trafficking, antigen presentation, and microbial killing are controlled by the Arf-like GTPase Arl8b.
More...