Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.77
PubTator Score 16.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.100 0.000

Synonym

Accession Q9NVI7 B3KPB3 D2K8Q1 G3V1I6 Q5SV23 Q8N275 Q96A50
Symbols HAYOS

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (18)

PMID Text
25823022 stabilization of WASF3 function occurs through its interaction with ATAD3A and GRP78, which may provide a bridge between the ER and mitochondria, allowing communication between the two organelles
25375035 These results demonstrate that ATAD3-mediated mitochondrial membrane formation participates in the optimal transfer of cholesterol from the endoplasmic reticulum into mitochondria.
24239551 exploring ATAD3 mRNA expression, we confirmed the existence of an alternative splicing in rodent and of several mRNA isoforms in human
24057885 High ATAD3A expression correlates with radioresistance in glioblastoma.
22664726 ATAD3B is a negative regulator of ATAD3A and may function as an adaptor of mitochondrial homeostasis and metabolism in human pluripotent embryonic stem cells and cancer cells.
22542587 Engineered a high copy strain expressing human ATAD3A-Myc-HIS at a relative high level (2.5mg/l of yeast culture)without significantly affecting yeast growth.Urea-denaturated ATAD3A-Myc-HIS bound to agarose-nickel beads and could be renatured and eluted.
22318359 ATAD3 may be implicated in an unknown but essential and growth-linked mitochondrial function existing since pluri-cellular organization and involved in tumorigenesis.
22192748 ATAD3 may therefore be implicated in an unknown but essential and growth-linked mitochondrial function existing since pluri-cellular -organization and involved in tumorigenesis.
22190034 HIV-1 Vpu is identified to have a physical interaction with ATPase family, AAA domain containing 3A (ATAD3A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21743956 Results show that HPV infection correlates with increased ATAD3A expression and drug resistance in uterine cervical cancer.
More...

AA Sequence

MSWLFGINKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRY      1 - 70
AKDALNLAQMQEQTLQLEQQSKLKMRLEALSLLHTLVWAWSLCRAGAVQTQERLSGSASPEQVPAGECCA     71 - 140
LQEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEES    141 - 210
VQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTL    211 - 280
FGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQ    281 - 350
VSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMD    351 - 420
YAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQ    421 - 490
HSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKLAQFDYG    491 - 560
RKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLKAEGPGRGDE    561 - 630
PSPS                                                                      631 - 634
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823022 2016 Mitochondrial ATAD3A combines with GRP78 to regulate the WASF3 metastasis-promoting protein.
25375035 2015 Mitochondria-associated membrane formation in hormone-stimulated Leydig cell steroidogenesis: role of ATAD3.
24239551 2014 Expression analysis of ATAD3 isoforms in rodent and human cell lines and tissues.
24057885 2013 Mitochondrial protein ATPase family, AAA domain containing 3A correlates with radioresistance in glioblastoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664726 2012 ATAD3B is a human embryonic stem cell specific mitochondrial protein, re-expressed in cancer cells, that functions as dominant negative for the ubiquitous ATAD3A.
22542587 2012 Yeast-based production and purification of HIS-tagged human ATAD3A, A specific target of S100B.
22453275 2012 Mitochondrial nucleoid interacting proteins support mitochondrial protein synthesis.
22318359 2012 ATAD3, a vital membrane bound mitochondrial ATPase involved in tumor progression.
More...