Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.29
PubTator Score 5.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.300 0.001
hepatocellular carcinoma 1.100 0.000
psoriasis -1.900 0.000
osteosarcoma -2.777 0.000
atypical teratoid / rhabdoid tumor -1.100 0.010
medulloblastoma, large-cell 1.200 0.002
lung cancer 2.800 0.001
group 3 medulloblastoma 1.600 0.003
nasopharyngeal carcinoma 1.100 0.000
Breast cancer 1.300 0.000
ductal carcinoma in situ 1.400 0.006
invasive ductal carcinoma 1.400 0.004
acute myeloid leukemia -1.100 0.036
pituitary cancer 1.400 0.000

Synonym

Accession Q9NVH2 B4DLZ6 B7WNP6 B7WPB6 Q8N4K7 Q8WUH5 Q9H9V3 Q9NVU5 Q9UFC6 Q9UFM3 Int7
Symbols INT7
C1orf73

Gene

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of integrator complex subunit 7 (INTS7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPRLFQKYPFPILINSAFLKLAD      1 - 70
VFRVGNNFLRLCVLKVTQQSEKHLEKILNVDEFVKRIFSVIHSNDPVARAITLRMLGSLASIIPERKNAH     71 - 140
HSIRQSLDSHDNVEVEAAVFAAANFSAQSKDFAVGICNKISEMIQGLATPVDLKLKLIPILQHMHHDAIL    141 - 210
ASSARQLLQQLVTSYPSTKMVIVSLHTFTLLAASSLVDTPKQIQLLLQYLKNDPRKAVKRLAIQDLKLLA    211 - 280
NKTPHTWSRENIQALCECALQTPYDSLKLGMLSVLSTLSGTIAIKHYFSIVPGNVSSSPRSSDLVKLAQE    281 - 350
CCYHNNRGIAAHGVRVLTNITVSCQEKDLLALEQDAVFGLESLLVLCSQDDSPGAQATLKIALNCMVKLA    351 - 420
KGRPHLSQSVVETLLTQLHSAQDAARILMCHCLAAIAMQLPVLGDGMLGDLMELYKVIGRSATDKQQELL    421 - 490
VSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVASEHFYF    491 - 560
WLNSLKEFSHAEQCLTGLQEENYSSALSCIAESLKFYHKGIASLTAASTPLNPLSFQCEFVKLRIDLLQA    561 - 630
FSQLICTCNSLKTSPPPAIATTIAMTLGNDLQRCGRISNQMKQSMEEFRSLASRYGDLYQASFDADSATL    631 - 700
RNVELQQQSCLLISHAIEALILDPESASFQEYGSTGTAHADSEYERRMMSVYNHVLEEVESLNRKYTPVS    701 - 770
YMHTACLCNAIIALLKVPLSFQRYFFQKLQSTSIKLALSPSPRNPAEPIAVQNNQQLALKVEGVVQHGSK    771 - 840
PGLFRKIQSVCLNVSSTLQSKSGQDYKIPIDNMTNEMEQRVEPHNDYFSTQFLLNFAILGTHNITVESSV    841 - 910
KDANGIVWKTGPRTTIFVKSLEDPYSQQIRLQQQQAQQPLQQQQQRNAYTRF                      911 - 962
//

Text Mined References (21)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
21269460 2011 Initial characterization of the human central proteome.
20457598 2010 The integrator complex recognizes a new double mark on the RNA polymerase II carboxyl-terminal domain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18213392 2008 Transcriptional regulation of an evolutionary conserved intergenic region of CDT2-INTS7.
More...