Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.83
PubTator Score 5.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.100 3.6e-02
atypical teratoid / rhabdoid tumor -1.100 1.0e-02
Breast cancer 1.300 3.2e-15
ductal carcinoma in situ 1.400 6.2e-03
gastric cancer 1.300 9.7e-04
group 3 medulloblastoma 1.600 3.2e-03
hepatocellular carcinoma 1.100 6.2e-06
invasive ductal carcinoma 1.400 3.9e-03
lung cancer 2.300 5.3e-03
medulloblastoma, large-cell 1.200 1.6e-03
nasopharyngeal carcinoma 1.100 3.0e-04
osteosarcoma -2.777 5.3e-07
pituitary cancer 1.400 9.7e-05
psoriasis -1.900 1.1e-04

 GO Function (1)

Gene RIF (2)

AA Sequence

MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPRLFQKYPFPILINSAFLKLAD      1 - 70
VFRVGNNFLRLCVLKVTQQSEKHLEKILNVDEFVKRIFSVIHSNDPVARAITLRMLGSLASIIPERKNAH     71 - 140
HSIRQSLDSHDNVEVEAAVFAAANFSAQSKDFAVGICNKISEMIQGLATPVDLKLKLIPILQHMHHDAIL    141 - 210
ASSARQLLQQLVTSYPSTKMVIVSLHTFTLLAASSLVDTPKQIQLLLQYLKNDPRKAVKRLAIQDLKLLA    211 - 280
NKTPHTWSRENIQALCECALQTPYDSLKLGMLSVLSTLSGTIAIKHYFSIVPGNVSSSPRSSDLVKLAQE    281 - 350
CCYHNNRGIAAHGVRVLTNITVSCQEKDLLALEQDAVFGLESLLVLCSQDDSPGAQATLKIALNCMVKLA    351 - 420
KGRPHLSQSVVETLLTQLHSAQDAARILMCHCLAAIAMQLPVLGDGMLGDLMELYKVIGRSATDKQQELL    421 - 490
VSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVASEHFYF    491 - 560
WLNSLKEFSHAEQCLTGLQEENYSSALSCIAESLKFYHKGIASLTAASTPLNPLSFQCEFVKLRIDLLQA    561 - 630
FSQLICTCNSLKTSPPPAIATTIAMTLGNDLQRCGRISNQMKQSMEEFRSLASRYGDLYQASFDADSATL    631 - 700
RNVELQQQSCLLISHAIEALILDPESASFQEYGSTGTAHADSEYERRMMSVYNHVLEEVESLNRKYTPVS    701 - 770
YMHTACLCNAIIALLKVPLSFQRYFFQKLQSTSIKLALSPSPRNPAEPIAVQNNQQLALKVEGVVQHGSK    771 - 840
PGLFRKIQSVCLNVSSTLQSKSGQDYKIPIDNMTNEMEQRVEPHNDYFSTQFLLNFAILGTHNITVESSV    841 - 910
KDANGIVWKTGPRTTIFVKSLEDPYSQQIRLQQQQAQQPLQQQQQRNAYTRF                      911 - 962
//

Text Mined References (23)

PMID Year Title