Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.34
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.2e-03
diabetes mellitus 1728 2.1e-03
invasive ductal carcinoma 2951 3.7e-03

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.100 2.1e-03
invasive ductal carcinoma -1.100 3.7e-03
osteosarcoma -1.129 1.2e-03

AA Sequence

MSSLHKSRIADFQDVLKEPSIALEKLRELSFSGIPCEGGLRCLCWKILLNYLPLERASWTSILAKQRELY      1 - 70
AQFLREMIIQPGIAKANMGVSREDVTFEDHPLNPNPDSRWNTYFKDNEVLLQIDKDVRRLCPDISFFQRA     71 - 140
TDYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVTNMSSPHKNSVPSSLNEYEVLPNGCEAHWEV    141 - 210
VERILFIYAKLNPGIAYVQGMNEIVGPLYYTFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDS    211 - 280
QCGITYKMEKVYSTLKDKDVELYLKLQEQNIKPQFFAFRWLTLLLSQEFLLPDVIRIWDSLFADDNRFDF    281 - 350
LLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDSK                        351 - 400
//

Text Mined References (9)

PMID Year Title