Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.93
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.272 2.7e-02
Breast cancer 1.100 6.5e-05
invasive ductal carcinoma 1.400 5.0e-03
lung carcinoma 1.300 7.4e-24
nephrosclerosis -1.114 7.2e-03
pancreatic ductal adenocarcinoma liver m... -2.264 1.3e-03
pituitary cancer 1.700 8.1e-04
psoriasis -1.700 1.9e-98

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRL      1 - 70
IQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCA     71 - 140
PKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMAKIHTIHANGSLPKPILWHKMHNYFTLVKNE    141 - 210
INPSLSADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFD    211 - 280
IGNHFNEFAGVNEVDYCLYPARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALI    281 - 350
QNQYSTIDFDFLRYAVIRFNQYFKVKPQASALEMPK                                      351 - 386
//

Text Mined References (13)

PMID Year Title