Property Summary

NCBI Gene PubMed Count 48
Grant Count 28
R01 Count 25
Funding $1,300,619.61
PubMed Score 228.12
PubTator Score 23.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytic glioma -1.300 0.029
cutaneous lupus erythematosus -1.100 0.036
atypical teratoid / rhabdoid tumor 1.100 0.003
adrenocortical carcinoma -1.417 0.000
lung cancer -2.100 0.000
colon cancer -1.900 0.005
diabetes mellitus -1.200 0.004
Polycystic Ovary Syndrome -1.102 0.004
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.700 0.002
ovarian cancer -2.200 0.000
chronic rhinosinusitis -1.043 0.001

Gene RIF (17)

PMID Text
26115385 Protein expression of alpha-Parvin increases with colorectal cancer progression.
25925587 alpha-pv-deficient HUVECs show reduced stable adherens junctions, decreased monolayer formation, and impaired motility, associated with reduced formation of integrin-mediated cell-extracellular matrix adhesion structures and an altered actin cytoskeleton.
25738875 PARVA promotes metastasis by modulating ILK signalling pathway in lung adenocarcinoma
24496929 alpha-Parvin, a pseudopodial constituent, was found to promote migration of breast cancer cells and to be expressed exclusively by Invasive lobular carcinoma
23504997 Actopaxin plays a role in hepatocellular carcinoma progression and metastasis, by way of regulation of cell invasiveness and motility, an epithelial-mesenchymal transition process, and chemosensitivity to cytotoxic drugs.
23099104 alpha-parvin, beta-parvin and migfilin were expressed in tumor cells in 53%, 2%, 28% and 53% of effusions and 57%, 20%, 83% and 25% of solid lesions, respectively.
23056266 beta2-adaptin is shown to bind to the focal adhesion protein actopaxin and localize to focal adhesions during cells spreading in an actopaxin dependent manner
22955285 Actopaxin phosphorylation is required for matrix degradation and cell invasion via regulation of Rho GTPase signaling.
22441983 results also identify the integrin-linked kinase (ILK) and alpha-parvin proteins as a new molecular partner and target, respectively, of the Lnk adaptor.
20400778 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDP      1 - 70
EDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK     71 - 140
LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDH    141 - 210
VSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN    211 - 280
LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIV    281 - 350
NCDLKSTLRVLYNLFTKYRNVE                                                    351 - 372
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26115385 2015 Focal Adhesion Proteins ?- and ?-Parvin are Overexpressed in Human Colorectal Cancer and Correlate with Tumor Progression.
25925587 2015 Endothelial alpha-parvin controls integrity of developing vasculature and is required for maintenance of cell-cell junctions.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25738875 2015 PARVA promotes metastasis by modulating ILK signalling pathway in lung adenocarcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24496929 2014 ?-Parvin, a pseudopodial constituent, promotes cell motility and is associated with lymph node metastasis of lobular breast carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23877428 2013 Interaction of smoothened with integrin-linked kinase in primary cilia mediates Hedgehog signalling.
More...