Property Summary

NCBI Gene PubMed Count 22
Grant Count 9
R01 Count 5
Funding $919,594.79
PubMed Score 7.70
PubTator Score 25.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.133 0.001
urothelial carcinoma 1.100 0.014
malignant mesothelioma 1.400 0.000
osteosarcoma -1.477 0.000
group 3 medulloblastoma 1.800 0.000
astrocytoma 1.200 0.013
glioblastoma 1.400 0.014
primitive neuroectodermal tumor 1.300 0.002
lung cancer 1.600 0.003
ovarian cancer 2.000 0.000

Gene RIF (6)

PMID Text
25482373 These findings suggest that hMED17 may play essential roles in switching between transcription and nucleotide excision repair.
25437875 TRAP80 is a selective regulator of hepatic lipogenesis and is required for LXR-dependent SREBP-1c activation.
21326907 Studies indicate that the activation domain of p53 (p53AD) binds directly to the MED17 subunit of Mediator, whereas the p53 C-terminal domain (p53CTD) binds the MED1 subunit.
20950787 the p. L371P mutation in MED17 is a founder mutation in the Caucasus Jewish community and that homozygosity for this mutation is associated with infantile cerebral and cerebellar atrophy with poor myelination.
18976975 Knockdown of MED17 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 17 (MED17) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEW      1 - 70
PGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQN     71 - 140
PQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYR    141 - 210
SAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRP    211 - 280
LPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLCHSSN    281 - 350
DKKSQKFATEKQCPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINS    351 - 420
LQSSEGLLEKIIKQAKHIFLRSRAAATIDSLASRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKS    421 - 490
IQLQLNIGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPI    491 - 560
ESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKM    561 - 630
EGRNFVYKMELLMSALSPCLL                                                     631 - 651
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25482373 2015 Human mediator MED17 subunit plays essential roles in gene regulation by associating with the transcription and DNA repair machineries.
25437875 2015 Hepatic TRAP80 selectively regulates lipogenic activity of liver X receptor.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21326907 Mediator and post-recruitment regulation of RNA polymerase II.
21269460 2011 Initial characterization of the human central proteome.
20950787 2010 Infantile cerebral and cerebellar atrophy is associated with a mutation in the MED17 subunit of the transcription preinitiation mediator complex.
19946888 2010 Defining the membrane proteome of NK cells.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...