Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.21
PubTator Score 25.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.200 1.3e-02
glioblastoma 1.400 1.4e-02
group 3 medulloblastoma 1.500 1.4e-03
lung cancer 1.600 3.3e-03
malignant mesothelioma 1.400 8.2e-07
Multiple myeloma 1.133 9.4e-04
osteosarcoma -1.477 5.3e-05
ovarian cancer -1.100 5.5e-03
primitive neuroectodermal tumor 1.100 2.2e-04
urothelial carcinoma 1.100 1.4e-02

Gene RIF (6)

AA Sequence

MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEW      1 - 70
PGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQN     71 - 140
PQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYR    141 - 210
SAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRP    211 - 280
LPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLCHSSN    281 - 350
DKKSQKFATEKQCPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINS    351 - 420
LQSSEGLLEKIIKQAKHIFLRSRAAATIDSLASRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKS    421 - 490
IQLQLNIGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPI    491 - 560
ESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKM    561 - 630
EGRNFVYKMELLMSALSPCLL                                                     631 - 651
//

Text Mined References (29)

PMID Year Title