Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.21
PubTator Score 0.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis 1.600 0.000
osteosarcoma 1.663 0.000
lung cancer 1.500 0.000
lung adenocarcinoma 1.200 0.000

Synonym

Accession Q9NVC3 Q53GJ9 Q9H9I5
Symbols SNAT7

Gene

PANTHER Protein Class (2)

AA Sequence

MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTSTLGAIFIVVNACLGAGLL      1 - 70
NFPAAFSTAGGVAAGIALQMGMLVFIISGLVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTF     71 - 140
GTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVG    141 - 210
TWYVTAIVIIKYIWPDKEMTPGNILTRPASWMAVFNAMPTICFGFQCHVSSVPVFNSMQQPEVKTWGGVV    211 - 280
TAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGL    281 - 350
WLRYQGVPVEEDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFVFPGLCLIQAKLS    351 - 420
EMEEVKPASWWVLVSYGVLLVTLGAFIFGQTTANAIFVDLLA                                421 - 462
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21511949 2011 Identification of SLC38A7 (SNAT7) protein as a glutamine transporter expressed in neurons.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.