Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.33
PubTator Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma 1.200 1.0e-11
lung cancer 1.500 9.4e-05
malignant mesothelioma -1.100 1.6e-05
osteosarcoma 1.663 4.6e-04
psoriasis 1.600 2.5e-04

AA Sequence

MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTSTLGAIFIVVNACLGAGLL      1 - 70
NFPAAFSTAGGVAAGIALQMGMLVFIISGLVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTF     71 - 140
GTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVG    141 - 210
TWYVTAIVIIKYIWPDKEMTPGNILTRPASWMAVFNAMPTICFGFQCHVSSVPVFNSMQQPEVKTWGGVV    211 - 280
TAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGL    281 - 350
WLRYQGVPVEEDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFVFPGLCLIQAKLS    351 - 420
EMEEVKPASWWVLVSYGVLLVTLGAFIFGQTTANAIFVDLLA                                421 - 462
//

Text Mined References (10)

PMID Year Title