Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.81
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acrocallosal syndrome 12 4.194 2.1
Hypertrichosis 46 3.898 1.9
spina bifida 1074 3.176 1.6

Expression

Synonym

Accession Q9NVA4 D3DP04 Q86X84 Q969I7 Q9NXM2
Symbols TMEM34

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQH      1 - 70
LVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNL     71 - 140
VLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAW    141 - 210
TYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTW    211 - 280
EWQTVEAVATGLQDFIICIEMFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRHV    281 - 350
GRTVRGHPRKKLFPEDQDQNEHTSLLSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEI    351 - 420
LSDTIGEKKEPSDKSVDS                                                        421 - 438
//

Text Mined References (9)

PMID Year Title