Property Summary

NCBI Gene PubMed Count 27
PubMed Score 29.79
PubTator Score 60.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Methylmalonic acidemia 39
Disease Target Count P-value
juvenile dermatomyositis 1189 5.06557287450198E-10
non-small cell lung cancer 2798 1.09334270821855E-9
psoriasis 6685 4.34737147447117E-9
Duchenne muscular dystrophy 602 8.12837801608662E-9
breast carcinoma 1614 2.07950101357892E-8
osteosarcoma 7933 1.6888990946374E-7
glioblastoma 5572 3.0342349597994E-7
medulloblastoma 1524 3.57293585078663E-7
atypical teratoid / rhabdoid tumor 4369 1.23841108595901E-6
pilocytic astrocytoma 3086 1.73000952267409E-6
primitive neuroectodermal tumor 3031 1.8246338899925E-6
medulloblastoma, large-cell 6234 1.00168220093945E-5
Pick disease 1893 1.26104057336262E-5
ovarian cancer 8492 1.82236683118762E-5
Breast cancer 3099 2.34041439621232E-5
lung cancer 4473 8.71793953817786E-5
ependymoma 2514 5.45664479812792E-4
cystic fibrosis 1670 7.65097018927071E-4
astrocytic glioma 2241 0.00110852325559143
invasive ductal carcinoma 2950 0.00146346585683282
primary pancreatic ductal adenocarcinoma 1271 0.00234475728053795
adult high grade glioma 2148 0.00302580920769189
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00536161874443659
oligodendroglioma 2849 0.00663211296045741
ductal carcinoma in situ 1745 0.00939479239330826
Polycystic Ovary Syndrome 335 0.0300837527014914
pancreatic cancer 2300 0.0315636992299047
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0359417189187041
gastric carcinoma 832 0.0430227867511899
Disease Target Count Z-score Confidence
Amyotrophic neuralgia 13 3.544 1.8

Expression

  Differential Expression (29)

Synonym

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Fruitfly OMA EggNOG

 GO Function (1)

Gene RIF (10)

PMID Text
25293760 Authors report here that the septins SEPT2, -9, -11, and probably -7 form fibrillar structures around the chlamydial inclusion.
22126117 The proteomic discovery of insoluble SEPT11 accumulation in FTLD-U, along with novel pathological associations, highlights a role for this cytoskeleton-associated protein in the pathogenesis of this complex disorder.
21504731 the role of SEPT2 and SEPT11 in the InlB-Met interactions
20978712 Cloned and characterised novel SEPT11 variants and investigated interaction partners of SEPT11 in platelets and human umbilical vein endothelial cells.
20419844 LOH in genes around D4S2964, including ARD1B and SEPT11 may play an important role in hepatocellular carcinoma development and progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19234302 SEPT2 is essential for the InlB-mediated entry of Listeria, but SEPT11 is not, which distinguishes the roles of different mammalian septins
17625225 Our finding suggests a role for members of the septin family in the development of proliferative retinal membranes.
17546647 SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling
15485874 Sept7/9b/11 form a complex that has effects on filament elongation, bundling, or disruption

AA Sequence

MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDP      1 - 70
ATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLF     71 - 140
NYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQ    141 - 210
IYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRV    211 - 280
NMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVK    281 - 350
EKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKD    351 - 420
KDKKNASFT                                                                 421 - 429
//

Text Mined References (34)

PMID Year Title
25293760 2014 Septins arrange F-actin-containing fibers on the Chlamydia trachomatis inclusion and are required for normal release of the inclusion by extrusion.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22126117 2011 Aberrant septin 11 is associated with sporadic frontotemporal lobar degeneration.
21504731 2011 A role for septins in the interaction between the Listeria monocytogenes INVASION PROTEIN InlB and the Met receptor.
21269460 2011 Initial characterization of the human central proteome.
20978712 2010 Human endothelial and platelet septin SEPT11: cloning of novel variants and characterisation of interaction partners.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20419844 2010 LOH analysis of genes around D4S2964 identifies ARD1B as a prognostic predictor of hepatocellular carcinoma.
More...