Property Summary

NCBI Gene PubMed Count 27
Grant Count 3
Funding $485,516.67
PubMed Score 29.79
PubTator Score 60.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

 GO Function (1)

Gene RIF (10)

PMID Text
25293760 Authors report here that the septins SEPT2, -9, -11, and probably -7 form fibrillar structures around the chlamydial inclusion.
22126117 The proteomic discovery of insoluble SEPT11 accumulation in FTLD-U, along with novel pathological associations, highlights a role for this cytoskeleton-associated protein in the pathogenesis of this complex disorder.
21504731 the role of SEPT2 and SEPT11 in the InlB-Met interactions
20978712 Cloned and characterised novel SEPT11 variants and investigated interaction partners of SEPT11 in platelets and human umbilical vein endothelial cells.
20419844 LOH in genes around D4S2964, including ARD1B and SEPT11 may play an important role in hepatocellular carcinoma development and progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19234302 SEPT2 is essential for the InlB-mediated entry of Listeria, but SEPT11 is not, which distinguishes the roles of different mammalian septins
17625225 Our finding suggests a role for members of the septin family in the development of proliferative retinal membranes.
17546647 SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling
15485874 Sept7/9b/11 form a complex that has effects on filament elongation, bundling, or disruption

AA Sequence

MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDP      1 - 70
ATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLF     71 - 140
NYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQ    141 - 210
IYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRV    211 - 280
NMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVK    281 - 350
EKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKD    351 - 420
KDKKNASFT                                                                 421 - 429
//

Publication (34)

PMID Year Title
25293760 2014 Septins arrange F-actin-containing fibers on the Chlamydia trachomatis inclusion and are required for normal release of the inclusion by extrusion.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22126117 2011 Aberrant septin 11 is associated with sporadic frontotemporal lobar degeneration.
21504731 2011 A role for septins in the interaction between the Listeria monocytogenes INVASION PROTEIN InlB and the Met receptor.
21269460 2011 Initial characterization of the human central proteome.
20978712 2010 Human endothelial and platelet septin SEPT11: cloning of novel variants and characterisation of interaction partners.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20419844 2010 LOH analysis of genes around D4S2964 identifies ARD1B as a prognostic predictor of hepatocellular carcinoma.
More...