Property Summary

NCBI Gene PubMed Count 29
PubMed Score 32.39
PubTator Score 60.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adult high grade glioma -2.200 3.0e-03
astrocytic glioma -3.100 1.1e-03
Astrocytoma, Pilocytic -2.600 2.3e-06
atypical teratoid / rhabdoid tumor 1.700 3.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.216 5.4e-03
Breast cancer 1.200 2.3e-05
breast carcinoma -1.100 2.1e-08
cystic fibrosis -1.300 7.7e-04
Duchenne muscular dystrophy 1.282 8.1e-09
ductal carcinoma in situ -1.200 9.4e-03
ependymoma -3.600 5.5e-04
gastric carcinoma 1.500 4.3e-02
glioblastoma -2.100 7.1e-07
group 3 medulloblastoma -2.200 2.2e-02
intraductal papillary-mucinous carcinoma... -1.300 3.6e-02
invasive ductal carcinoma -1.200 1.6e-02
juvenile dermatomyositis 1.010 5.1e-10
lung cancer -1.800 8.7e-05
medulloblastoma, large-cell 2.100 2.9e-04
non-small cell lung cancer -1.158 1.1e-09
oligodendroglioma -2.700 6.6e-03
osteosarcoma 1.477 1.0e-03
ovarian cancer -1.300 4.1e-04
pancreatic cancer 1.300 3.2e-02
Pick disease -1.200 3.9e-03
Polycystic ovary syndrome -1.121 4.9e-02
primary pancreatic ductal adenocarcinoma 1.302 9.7e-03
primitive neuroectodermal tumor -2.700 1.8e-06
psoriasis -1.300 6.1e-06

Gene RIF (11)

AA Sequence

MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDP      1 - 70
ATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLF     71 - 140
NYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQ    141 - 210
IYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRV    211 - 280
NMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVK    281 - 350
EKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKD    351 - 420
KDKKNASFT                                                                 421 - 429
//

Text Mined References (36)

PMID Year Title