Property Summary

NCBI Gene PubMed Count 33
PubMed Score 17.59
PubTator Score 15.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.9e-04
intraductal papillary-mucinous carcinoma... 1.100 7.8e-04
intraductal papillary-mucinous neoplasm ... 2.000 4.1e-04
osteosarcoma -1.201 2.2e-03
Pick disease -1.100 5.7e-07
psoriasis 1.700 1.9e-04

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MALLVRVLRNQTSISQWVPVCSRLIPVSPTQGQGDRALSRTSQWPQMSQSRACGGSEQIPGIDIQLNRKY      1 - 70
HTTRKLSTTKDSPQPVEEKVGAFTKIIEAMGFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMP     71 - 140
DTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYA    141 - 210
AILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVE    211 - 280
KNPQSILKPHSPTYNDEGL                                                       281 - 299
//

Text Mined References (36)

PMID Year Title