Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.49
PubTator Score 11.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.104 8.0e-03
acute quadriplegic myopathy 1.199 7.2e-05
Alzheimer's disease -1.100 4.6e-02
Astrocytoma, Pilocytic 1.100 1.3e-02
atypical teratoid / rhabdoid tumor -1.700 1.2e-04
Breast cancer 2.100 4.8e-02
diabetes mellitus -1.100 1.2e-03
glioblastoma -1.100 5.5e-04
hereditary spastic paraplegia -1.007 2.5e-02
juvenile dermatomyositis 1.315 9.7e-12
lung cancer -1.900 1.9e-05
medulloblastoma, large-cell -1.100 8.1e-04
Multiple myeloma 1.306 1.7e-02
oligodendroglioma 1.500 4.6e-03
osteosarcoma -1.224 1.1e-03
ovarian cancer -1.300 8.7e-03
pancreatic ductal adenocarcinoma liver m... -1.508 1.4e-02
Pick disease -1.400 9.6e-04
Polycystic ovary syndrome -1.298 1.7e-02
progressive supranuclear palsy -1.200 3.0e-02
psoriasis 1.100 1.7e-03

Gene RIF (7)

AA Sequence

MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFV      1 - 70
TSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDD     71 - 140
SQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDK    141 - 210
NVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKS    211 - 280
DLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKY    281 - 350
RNSSNTADITI                                                               351 - 361
//

Text Mined References (23)

PMID Year Title