Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.66
PubTator Score 11.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.306 0.017
oligodendroglioma 1.500 0.005
osteosarcoma 3.307 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma 1.200 0.013
medulloblastoma, large-cell -1.900 0.000
acute quadriplegic myopathy 1.260 0.001
hereditary spastic paraplegia -1.007 0.025
juvenile dermatomyositis 1.315 0.000
pancreatic ductal adenocarcinoma liver m... -1.508 0.014
lung cancer -1.900 0.000
active Crohn's disease 1.104 0.008
diabetes mellitus -1.100 0.001
Breast cancer 2.100 0.048
pilocytic astrocytoma 1.100 0.012
psoriasis 1.100 0.002
Polycystic Ovary Syndrome -1.298 0.017
Alzheimer's disease -1.500 0.033
Pick disease -1.700 0.000
progressive supranuclear palsy -1.700 0.009
ovarian cancer 2.800 0.000

Synonym

Accession Q9NV96 A8K9V8 E1P539 Q658Z3 Q96H09 Q9NSL9
Symbols CDC50A
C6orf67

Gene

Gene RIF (7)

PMID Text
25239307 Data indicate that the lipid flippase (ATP8B1)-transmembrane protein 30A (CDC50A) heterodimer is essential for the apical localization of sodium-dependent bile acid transporter (SLC10A2/ASBT) in Caco-2 cells.
24904167 ATP11C and CDC50A are required for aminophospholipid translocation from the outer to the inner plasma membrane leaflet; that is, they display flippase activity.
23269685 the phospholipid flippase complex of ATP8A1 and CDC50A proteins has a role in cell migration
21454556 CDC50A is the beta-subunit of ATP8A2 and is crucial for the correct folding, stable expression, export from endoplasmic reticulum, and phosphatidylserine flippase activity of ATP8A2
21289302 Import of choline phospholipids into Saccharomyces cerevisiae DeltaLem3 vector is partially reconstituted by human TMEM30a and by Lem3p-TMEM30a chimeras, showing that the proteins are orthologous.
20510206 CDC50A plays a key role in perifosine uptake in human cells, presumably by forming a functional plasma membrane translocator.
17948906 CDC50A may be the potential beta-subunit or chaperone for ATP8B1 in hepatocytes.

AA Sequence

MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFV      1 - 70
TSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDD     71 - 140
SQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDK    141 - 210
NVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKS    211 - 280
DLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKY    281 - 350
RNSSNTADITI                                                               351 - 361
//

Text Mined References (23)

PMID Year Title
25239307 2014 The lipid flippase heterodimer ATP8B1-CDC50A is essential for surface expression of the apical sodium-dependent bile acid transporter (SLC10A2/ASBT) in intestinal Caco-2 cells.
24904167 2014 Caspase-mediated cleavage of phospholipid flippase for apoptotic phosphatidylserine exposure.
23269685 2013 Role for phospholipid flippase complex of ATP8A1 and CDC50A proteins in cell migration.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
21454556 2011 Critical role of the beta-subunit CDC50A in the stable expression, assembly, subcellular localization, and lipid transport activity of the P4-ATPase ATP8A2.
21289302 2011 Human TMEM30a promotes uptake of antitumor and bioactive choline phospholipids into mammalian cells.
20961850 2010 CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery.
20947505 2010 Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases.
20510206 2010 CDC50A plays a key role in the uptake of the anticancer drug perifosine in human carcinoma cells.
19946888 2010 Defining the membrane proteome of NK cells.
More...