Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.49
PubTator Score 4.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
pancreatic cancer 1.200 4.8e-02
adult high grade glioma -2.100 6.8e-04
astrocytic glioma -1.100 2.0e-02
Astrocytoma, Pilocytic -1.300 2.9e-04
atypical teratoid / rhabdoid tumor -2.900 1.5e-09
Breast cancer -1.200 4.8e-12
ependymoma -2.000 2.7e-02
glioblastoma -2.000 2.8e-07
group 3 medulloblastoma -1.400 2.6e-02
interstitial cystitis -1.500 4.5e-03
lung adenocarcinoma -1.100 2.0e-07
medulloblastoma, large-cell -3.100 2.8e-05
oligodendroglioma -1.800 8.0e-20
osteosarcoma 1.224 2.3e-02
ovarian cancer -1.700 7.0e-10
pancreatic carcinoma 1.200 4.8e-02
pancreatic ductal adenocarcinoma liver m... -1.069 7.9e-03
Pick disease -1.500 1.8e-04
pituitary cancer 1.200 1.5e-03
primitive neuroectodermal tumor -2.200 1.5e-05
spina bifida -1.892 3.8e-02
tuberculosis -1.400 1.4e-04
ulcerative colitis -1.300 6.6e-05

Gene RIF (6)

AA Sequence

MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSS      1 - 70
TGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAP     71 - 140
ALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQE    141 - 210
EECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVR    211 - 280
FSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL                  281 - 336
//

Text Mined References (16)

PMID Year Title