Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.85
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
oligodendroglioma 2849 8.02215840180443E-20
Breast cancer 3099 4.77486995095092E-12
atypical teratoid / rhabdoid tumor 4369 1.46704886032456E-9
medulloblastoma 1524 1.20506582353491E-8
glioblastoma 5572 1.95275492139695E-7
lung adenocarcinoma 2714 2.02240879165221E-7
pituitary cancer 1972 4.18457683654065E-6
interstitial cystitis 2299 5.38345363102082E-6
pediatric high grade glioma 2712 8.60723717509691E-6
primitive neuroectodermal tumor 3031 1.48846915209231E-5
medulloblastoma, large-cell 6234 2.84959662173284E-5
tuberculosis and treatment for 3 months 327 4.22274592821946E-5
ulcerative colitis 2087 6.58504925925777E-5
pilocytic astrocytoma 3086 2.7053721302076E-4
osteosarcoma 7933 3.90563064719337E-4
astrocytic glioma 2241 0.0012463865601126
Pick disease 1893 0.00414677196883529
ovarian cancer 8492 0.00427154155946131
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00787206616866188
ependymoma 2514 0.0267887150969079
spina bifida 1064 0.0462699549134428
pancreatic cancer 2300 0.0475926567714246
pancreatic carcinoma 567 0.047592656771425
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0

Expression

  Differential Expression (23)

Disease log2 FC p
pancreatic cancer 1.200 0.048
astrocytic glioma -1.800 0.001
ependymoma -2.000 0.027
glioblastoma -2.900 0.000
oligodendroglioma -1.800 0.000
osteosarcoma 1.942 0.000
medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -2.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.069 0.008
tuberculosis and treatment for 3 months -1.800 0.000
interstitial cystitis -1.700 0.000
pediatric high grade glioma -2.200 0.000
pilocytic astrocytoma -1.300 0.000
pancreatic carcinoma 1.200 0.048
lung adenocarcinoma -1.100 0.000
spina bifida -2.104 0.046
Pick disease -2.000 0.004
Breast cancer -1.200 0.000
ulcerative colitis -1.300 0.000
ovarian cancer 2.000 0.004
pituitary cancer 1.700 0.000

Synonym

Accession Q9NV92 Q7Z2H3 Q7Z428 Q8TAR3 Q9ULQ5
Symbols N4WBP5A

Gene

  Ortholog (12)

Pathway (1)

Gene RIF (6)

PMID Text
26363003 Data show that membrane protein Ndfip1 recruits E3 ubiquitin (Ub) ligase Nedd4-2 to the Golgi to target ether-a-go-go-related gene (hERG) channel for degradation while membrane protein Ndfip2 also mediates Nedd4-2 interaction with hERG in the Golgi.
20534535 PTEN/Akt and MAP kinase signaling pathways are regulated by the ubiquitin ligase activators Ndfip1 and Ndfip2
19343052 Data show that the small PY-containing membrane proteins, NDFIP1 and NDFIP2 (NEDD4 family-interacting proteins), activate the catalytic activity of ITCH and of several other HECT ligases by binding to them.
15252135 N4WBP5A acts as an adaptor to recruit Nedd4 family ubiquitin-protein ligases to the protein trafficking machinery
12796489 N4WBP5A may play a regulatory role in modulating Nedd4 activity at the level of the Golgi apparatus in T lymphocytes
12050153 role in regulating epithelial sodium channel

AA Sequence

MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSS      1 - 70
TGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAP     71 - 140
ALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQE    141 - 210
EECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVR    211 - 280
FSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL                  281 - 336
//

Text Mined References (16)

PMID Year Title
26363003 2015 Regulation of the human ether-a-go-go-related gene (hERG) potassium channel by Nedd4 family interacting proteins (Ndfips).
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
20686608 2010 Genome-wide association study of pancreatic cancer in Japanese population.
20534535 2010 Regulation of PTEN/Akt and MAP kinase signaling pathways by the ubiquitin ligase activators Ndfip1 and Ndfip2.
19343052 2009 Control of the activity of WW-HECT domain E3 ubiquitin ligases by NDFIP proteins.
18776082 2008 Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252135 2004 N4WBP5A (Ndfip2), a Nedd4-interacting protein, localizes to multivesicular bodies and the Golgi, and has a potential role in protein trafficking.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...