Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.3891498785056E-8
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0233055295746371

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.916 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.023

Synonym

Accession Q9NV72 A2RRM8 B9EGF2 F5GZM6 Q66K42
Symbols

Gene

Gene RIF (1)

PMID Text
19460752 Knockdown of zinc finger protein 701 (ZNF701) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MGFLHVGQDGLELPTSGDPPASASQSAGITGVSHRTQPPCFEGLTSKDLVREEKTRKRKRKAKESGMALL      1 - 70
QGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDTSSKCMMKMFSSTGQGNTEVVHTGTL     71 - 140
QIHASHHIGDTCFQEIEKDIHDFVFQWQENETNGHEALMTKTKKLMSSTERHDQRHAGNKPIKNELGSSF    141 - 210
HSHLPEVHIFHPEGKIGNQVEKAINDAFSVSASQRISCRPKTRISNKYRNNFLQSSLLTQKREVHTREKS    211 - 280
FQRNESGKAFNGSSLLKKHQIIHLGDKQYKCDVCGKDFHQKRYLACHRCHTGENPYTCNECGKTFSHNSA    281 - 350
LLVHKAIHTGEKPYKCNECGKVFNQQSNLARHHRVHTGEKPYKCEECDKVFSRKSHLERHRRIHTGEKPY    351 - 420
KCKVCDKAFRRDSHLAQHTVIHTGEKPYKCNECGKTFVQNSSLVMHKVIHTGEKRYKCNECGKVFNHKSN    421 - 490
LACHRRLHTGEKPYKCNECGKVFNRKSNLERHHRLHTGKKS                                 491 - 531
//

Text Mined References (5)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.