Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Relevance (2)


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.916 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.023

Gene RIF (1)

19460752 Knockdown of zinc finger protein 701 (ZNF701) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

LACHRRLHTGEKPYKCNECGKVFNRKSNLERHHRLHTGKKS                                 491 - 531

Publication (5)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.