Property Summary

NCBI Gene PubMed Count 23
Grant Count 60
R01 Count 29
Funding $5,603,815.78
PubMed Score 76.16
PubTator Score 49.82

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NV70 Q504V4 Q8WUE7 Q96T15 Q9NZE4
Symbols SEC3
SEC3P
BM-102
SEC3L1

Gene

PANTHER Protein Class (1)

 GWAS Trait (1)

Gene RIF (7)

PMID Text
25591774 Ezrin/Sec3 complexes are essential for MUC5AC secretion in NE-stimulated airway epithelial cells and that PIP2 is of critical importance in the formation of these complexes.
23522008 This study portrayed the non-structural function of C protein that helped the flavivirus to nullify the antiviral activity of hSec3p by accelerating its degradation and facilitating efficient binding of elongation factor 1alpha with flaviviral RNA genome.
22534017 HIV-1 Nef interacts with EXOC1 and this interaction is dependent on the GTPase interaction site of PAK2
20160627 HIV-1 Nef interacts with EXOC1 and this interaction is dependent on the GTPase interaction site of PAK2
19889837 Sec3 associates with a subset of Exocyst complexes that are enriched at desmosomes.
19889084 This study identified human Sec3 exocyst protein (hSec3p) as a novel interacting partner of West Nile virus and Dengue virus C protein.
18541705 The exocyst subunits Sec3 and Sec8 interact with the polarity protein IQGAP1 and that this interaction is triggered by active Cdc42 and RhoA, which are essential for matrix degradation.

AA Sequence

MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAW      1 - 70
ALRDLAVVDAKDAIKENPEFDLHFEKIYKWVASSTAEKNAFISCIWKLNQRYLRKKIDFVNVSSQLLEES     71 - 140
VPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEYAISNAEAFAEKLSRELQVLDGANIQSIMAS    141 - 210
EKQVNILMKLLDEALKEVDQIELKLSSYEEMLQSVKEQMDQISESNHLIHLSNTNNVKLLSEIEFLVNHM    211 - 280
DLAKGHIKALQEGDLASSRGIEACTNAADALLQCMNVALRPGHDLLLAVKQQQQRFSDLRELFARRLASH    281 - 350
LNNVFVQQGHDQSSTLAQHSVELTLPNHHPFHRDLLRYAKLMEWLKSTDYGKYEGLTKNYMDYLSRLYER    351 - 420
EIKDFFEVAKIKMTGTTKESKKFATLPRKESAVKQETESLHGSSGKLTGSTSSLNKLSVQSSGNRRSQSS    421 - 490
SLLDMGNMSASDLDVADRTKFDKIFEQVLSELEPLCLAEQDFISKFFKLQQHQSMPGTMAEAEDLDGGTL    491 - 560
SRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPAS    561 - 630
FLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDK    631 - 700
AYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYS    701 - 770
LGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEE    771 - 840
NLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH                    841 - 894
//

Publication (32)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25591774 2015 Ezrin/Exocyst complex regulates mucin 5AC secretion induced by neutrophil elastase in human airway epithelial cells.
24344185 2013 Endosomal WASH and exocyst complexes control exocytosis of MT1-MMP at invadopodia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23817570 2013 A genome-wide association study identifies two new cervical cancer susceptibility loci at 4q12 and 17q12.
23522008 2013 West Nile virus and dengue virus capsid protein negates the antiviral activity of human Sec3 protein through the proteasome pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21241894 2011 RalB and the exocyst mediate the cellular starvation response by direct activation of autophagosome assembly.
More...