Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
Funding $15,000
PubMed Score 15.30
PubTator Score 9.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.500 0.015
ependymoma 1.800 0.005
oligodendroglioma 1.200 0.027
psoriasis -1.400 0.000
osteosarcoma 1.115 0.012
medulloblastoma, large-cell -1.400 0.005
juvenile dermatomyositis 1.183 0.000
acute quadriplegic myopathy 1.166 0.000
invasive ductal carcinoma 1.100 0.010
ovarian cancer 1.600 0.005

Synonym

Accession Q9NV58 A3KCU9 Q52LG1 Q9H5H9 Q9H8M8 Q9UFG0 Q9UFX6 Q9Y4Y1
Symbols RNF19

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (9)

PMID Text
22493721 A more than 2-fold higher level of RNF19A mRNA in the blood of patients with prostate cancer than in healthy controls makes it an early diagnosis marker for this disease.
22082156 Knockdown of ring finger protein 19A, E3 ubiquitin protein ligase (RNF19A) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18721867 Findings suggest that RNF19 has acquired a new promoter and alternative exons via continuous retrotransposition.
17157513 Dorfin-CHIP(L) rescued neuronal cells from mutant SOD1-associated toxicity and reduced the aggresome formation induced by mutant SOD1 more effectively than did Dorfin(WT).
15456787 Valosin-containing protein functionally regulates Dorfin through direct interaction
15030390 Reducing the accumulation of mutant superoxide dismutase 1 [SOD1] in the mitochondria may be a new therapeutic strategy for mutant SOD1-associated familial amyotrophic lateral sclerosis, and Dorfin may play a significant role in this
12875980 These results suggest that Dorfin plays a crucial role in the formation of ubiquitylated inclusions of alpha-synucleinopathy and amyotrophic lateral sclerosis.
12750386 results suggest that synphilin-1 has an important role in the formation of aggregates and cytotoxicity in Parkinson disease and that Dorfin may be involved in the pathogenic process by ubiquitylation of synphilin-1
12145308 Dorfin has a role in ubiquitylating mutant SOD1 proteins and targeting them for proteasomal degradation

AA Sequence

MQEQEIGFISKYNEGLCVNTDPVSILTSILDMSLHRQMGSDRDLQSSASSVSLPSVKKAPKKRRISIGSL      1 - 70
FRRKKDNKRKSRELNGGVDGIASIESIHSEMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHS     71 - 140
KDRFPDIMTCHHRSCVDCLRQYLRIEISESRVNISCPECTERFNPHDIRLILSDDVLMEKYEEFMLRRWL    141 - 210
VADPDCRWCPAPDCGYAVIAFGCASCPKLTCGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTI    211 - 280
RSSSISYSQESGAAADDIKPCPRCAAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFW    281 - 350
GKKPWSRKKKILWQLGTLVGAPVGIALIAGIAIPAMIIGIPVYVGRKIHNRYEGKDVSKHKRNLAIAGGV    351 - 420
TLSVIVSPVVAAVTVGIGVPIMLAYVYGVVPISLCRSGGCGVSAGNGKGVRIEFDDENDINVGGTNTAVD    421 - 490
TTSVAEARHNPSIGEGSVGGLTGSLSASGSHMDRIGAIRDNLSETASTMALAGASITGSLSGSAMVNCFN    491 - 560
RLEVQADVQKERYSLSGESGTVSLGTVSDNASTKAMAGSILNSYIPLDKEGNSMEVQVDIESKPSKFRHN    561 - 630
SGSSSVDDGSATRSHAGGSSSGLPEGKSSATKWSKEATAGKKSKSGKLRKKGNMKINETREDMDAQLLEQ    631 - 700
QSTNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMKTSCSHGSSDYHTRFATVNILPEVENDRLEN    701 - 770
SPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTEI      771 - 838
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22493721 2012 Averaged differential expression for the discovery of biomarkers in the blood of patients with prostate cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21041692 2010 Identification of genomic predictors of atrioventricular conduction: using electronic medical records as a tool for genome science.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18721867 2008 Cooperative exonization of MaLR and AluJo elements contributed an alternative promoter and novel splice variants of RNF19.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17157513 2007 Dorfin-CHIP chimeric proteins potently ubiquitylate and degrade familial ALS-related mutant SOD1 proteins and reduce their cellular toxicity.
16513638 2006 Calcium-sensing receptor ubiquitination and degradation mediated by the E3 ubiquitin ligase dorfin.
More...