Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.72
PubTator Score 5.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.900 4.2e-02
esophageal adenocarcinoma 1.100 2.9e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-03
lung cancer 1.200 1.1e-02
malignant mesothelioma 1.400 3.1e-06
osteosarcoma -1.130 2.1e-03
ovarian cancer 1.100 1.5e-05
psoriasis -1.200 4.5e-04

Gene RIF (4)

AA Sequence

MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGR      1 - 70
QVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGA     71 - 140
DDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT          141 - 204
//

Text Mined References (24)

PMID Year Title