Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.30
PubTator Score 5.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
esophageal adenocarcinoma 1.100 0.029
psoriasis -1.200 0.000
osteosarcoma -1.130 0.002
intraductal papillary-mucinous neoplasm ... 1.100 0.001
lung cancer 1.800 0.000
Breast cancer 1.900 0.042
ovarian cancer 1.100 0.000

Synonym

Accession Q9NV56 A8C4L5
Symbols Eaf7
URCC4
MRG15BP
C20orf20

Gene

PDB

2N1D  

Gene RIF (4)

PMID Text
21602893 role in tumorogenesis of cutaneous squamous cell carcinoma
21535316 MRGBP contributes to colorectal carcinogenesis through rendering advantages in cell proliferation and/or division of cancer cells.
20051959 These results suggest that C20orf20 protein has an important function in proliferation of cancer cells through the regulation of BRD8 protein.
12963728 MRGBP is encoded by the FLJ10914 ORF and is a new component of the TRRAP/TIP60 HAT complex

AA Sequence

MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGR      1 - 70
QVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGA     71 - 140
DDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT          141 - 204
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21602893 2011 Integrative mRNA profiling comparing cultured primary cells with clinical samples reveals PLK1 and C20orf20 as therapeutic targets in cutaneous squamous cell carcinoma.
21535316 2011 MRG-binding protein contributes to colorectal cancer development.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20051959 2010 C20orf20 (MRG-binding protein) as a potential therapeutic target for colorectal cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...