Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.80

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MPASATAAWHCPPLCLPPLPASAPTSPPNPATRPAPGPGRRARCPQSAHPAPTRGALTFWAPGSWPRVLL      1 - 70
VPRSPGPVLRAPRLPHPAARARRRAWHGARLPGSPARAGRTFQRGLVSNSWAHAIFLPRPPNVLELQV       71 - 138
//

Text Mined References (3)

PMID Year Title