Property Summary

NCBI Gene PubMed Count 31
PubMed Score 37.93
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-03
astrocytic glioma -1.800 9.4e-03
glioblastoma -1.200 2.7e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.7e-03
lung cancer 1.600 7.5e-03
ovarian cancer 1.800 7.4e-05

Gene RIF (23)

AA Sequence

MTASAQPRGRRPGVGVGVVVTSCKHPRCVLLGKRKGSVGAGSFQLPGGHLEFGETWEECAQRETWEEAAL      1 - 70
HLKNVHFASVVNSFIEKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRC     71 - 140
LKEQGYDPFKEDLNHLVGYKGNHL                                                  141 - 164
//

Text Mined References (33)

PMID Year Title