Property Summary

NCBI Gene PubMed Count 55
Grant Count 16
R01 Count 16
Funding $1,197,206.83
PubMed Score 1.83
PubTator Score 123.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Rheumatoid Arthritis 1,160

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.003

 GO Process (1)

Gene RIF (32)

PMID Text
26837693 IMP3 represents a biomarker of unfavorable prognosis for clear cell carcinomas of the ovary, even in stage I patients.
26826410 Describe chromosome 12p abnormalities and IMP3 expression in prepubertal pure testicular teratomas.
26617820 IMP3 expression in biopsy specimens could be used to predict lymph node metastasis and TNM stage in colorectal cancer patients
26403409 IMP-3 expression is not a useful discriminator between dysplastic nevi and melanoma nor a good prognostic marker in melanoma.
26353850 This is the first study evaluating the IMP3 immunohistochemical expression in Phyllodes tumor. Its expression correlates with histological grade and could be used in the differential diagnosis of fibroepithelial tumors and in prognostication.
26158423 Testing for a combination of elevated IMP3 and Lin28B levels could further facilitate the identification of a patient subgroup with the worst prognosis.
25982283 we show that SOX2 is a transcriptional target of SLUG. These data establish a novel mechanism of breast tumor initiation involving IMP3 and they provide a rationale for its association with aggressive disease and poor outcome.
25919292 IMP3 promotes renal cell carcinoma cell migration and invasion by activation of NF-small ka, CyrillicB pathway.
25886367 These results suggest that IMP3 facilitates PDAC progression by enhancing the pro-metastatic behaviour of tumour cells.
25740666 Positive expression of IMP3 in spinal giant cell tumor was associated with increased microvessel density and expression of IGF2.
More...

AA Sequence

MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQ      1 - 70
FRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGP     71 - 140
DVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA                              141 - 184
//

Text Mined References (56)

PMID Year Title
26837693 2016 Clear cell carcinomas of the ovary: a mono-institutional study of 73 cases in China with an analysis of the prognostic significance of clinicopathological parameters and IMP3 expression.
26826410 2016 Chromosome 12p abnormalities and IMP3 expression in prepubertal pure testicular teratomas.
26617820 2015 IMP3 expression in biopsy specimens of colorectal cancer predicts lymph node metastasis and TNM stage.
26403409 IMP-3 EXPRESSION IN BENIGN MELANOCYTIC NEVI, DYSPLASTIC NEVI AND MALIGNANT MELANOMA: PRELIMINARY FINDINGS IN BULGARIAN PATIENTS.
26353850 2016 IMP3 Is Strongly Expressed in Malignant Phyllodes Tumors of the Breast: An Immunohistochemical Study.
26158423 2015 Overexpression of the RNA-binding proteins Lin28B and IGF2BP3 (IMP3) is associated with chemoresistance and poor disease outcome in ovarian cancer.
25982283 2016 IMP3 promotes stem-like properties in triple-negative breast cancer by regulating SLUG.
25919292 2015 Enhanced IMP3 Expression Activates NF-?B Pathway and Promotes Renal Cell Carcinoma Progression.
25886367 2015 The involvement of insulin-like growth factor 2 binding protein 3 (IMP3) in pancreatic cancer cell migration, invasion, and adhesion.
25740666 2015 Expression of IMP3 and IGF2 in giant cell tumor of spine is associated with tumor recurrence and angiogenesis.
More...