Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.27
PubTator Score 4.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NV29 D3DTY7 I3L214 Q96FZ0
Symbols

Gene

Pathway (1)

Gene RIF (4)

PMID Text
25978032 The current findings suggest that TMEM100 functions as a tumor suppressor in hepatocellular carcinoma metastasis and proliferation.
23485812 This study demonistrated that TMEM100 is a novel, membrane-associated marker for enteric nerves and is as effective as PGP9.5 for identifying neuronal structures in the gastrointestinal tract.
22223368 Loss of TMEM100 is associated with lung adenocarcinoma.
19058789 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPFAVVVFIAGIV      1 - 70
VTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRESQTALVANQRSLFA           71 - 134
//

Text Mined References (14)

PMID Year Title
25978032 2015 Novel roles of TMEM100: inhibition metastasis and proliferation of hepatocellular carcinoma.
25640077 2015 Tmem100 Is a Regulator of TRPA1-TRPV1 Complex and Contributes to Persistent Pain.
25416956 2014 A proteome-scale map of the human interactome network.
23485812 2013 Distribution of TMEM100 in the mouse and human gastrointestinal tract--a novel marker of enteric nerves.
22783020 2012 Tmem100, an ALK1 receptor signaling-dependent gene essential for arterial endothelium differentiation and vascular morphogenesis.
22223368 2012 Association of lung adenocarcinoma clinical stage with gene expression pattern in noninvolved lung tissue.
22021425 2012 Genome-wide association study of body height in African Americans: the Women's Health Initiative SNP Health Association Resource (SHARe).
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...