Property Summary

NCBI Gene PubMed Count 6
PubMed Score 12.05
PubTator Score 13.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.8e-21
malignant mesothelioma 3232 2.0e-08
Disease Target Count Z-score Confidence
Melioidosis 17 3.551 1.8
Migraine 83 3.158 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -3.300 2.0e-08
psoriasis -2.000 6.8e-21

Gene RIF (1)

AA Sequence

MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEP      1 - 70
LENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHR     71 - 140
IPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGS    141 - 210
EDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF                   211 - 265
//

Text Mined References (7)

PMID Year Title