Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.07
PubTator Score 3.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (1)

AA Sequence

MAGPRPRWRDQLLFMSIIVLVIVVICLMFYALLWEAGNLTDLPNLRIGFYNFCLWNEDTSTLQCHQFPEL      1 - 70
EALGVPRVGLGLARLGVYGSLVLTLFAPQPLLLAQCNSDERAWRLAVGFLAVSSVLLAGGLGLFLSYVWK     71 - 140
WVRLSLPGPGFLALGSAQALLILLLIAMAVFPLRAERAESKLESC                             141 - 185
//

Text Mined References (12)

PMID Year Title