Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.07
PubTator Score 3.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.55577939387056E-11
juvenile dermatomyositis 1189 3.7663582218293E-9
lung carcinoma 2844 3.94253139693938E-9
malignant mesothelioma 3163 1.06531984301041E-7
lung adenocarcinoma 2714 3.16864371934852E-6
hepatocellular carcinoma 550 1.61388315330685E-5
pancreatic cancer 2300 2.7167498499481E-4
pancreatic carcinoma 567 2.71674984994811E-4
osteosarcoma 7933 4.03353639056338E-4
lung cancer 4473 6.46183212409955E-4
fibroadenoma 557 0.00129253030024283
non diabetic and post-ischemic heart failure 200 0.00129441702488092
cutaneous lupus erythematosus 1056 0.00136251785299415
ductal carcinoma in situ 1745 0.00210955328065241
tuberculosis and treatment for 6 months 686 0.00224140206894238
subependymal giant cell astrocytoma 2287 0.00246186848208726
invasive ductal carcinoma 2950 0.0092914273238026
diabetes mellitus 1663 0.0131048425136695
dermatomyositis 967 0.0167539130383459
mucosa-associated lymphoid tissue lymphoma 480 0.0191006656672071
type II diabetes mellitus and post-ischemic heart failure 89 0.019406807616222

Expression

Synonym

Accession Q9NV12 A4D1P9 Q8WUC3
Symbols

Gene

  Ortholog (7)

Gene RIF (1)

PMID Text
25036476 Binding of viral UL31 to host TMEM140 impedes formation of HSV-1 UL31-UL34 complex.

AA Sequence

MAGPRPRWRDQLLFMSIIVLVIVVICLMFYALLWEAGNLTDLPNLRIGFYNFCLWNEDTSTLQCHQFPEL      1 - 70
EALGVPRVGLGLARLGVYGSLVLTLFAPQPLLLAQCNSDERAWRLAVGFLAVSSVLLAGGLGLFLSYVWK     71 - 140
WVRLSLPGPGFLALGSAQALLILLLIAMAVFPLRAERAESKLESC                             141 - 185
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25036476 2014 HSV-1 nucleocapsid egress mediated by UL31 in association with UL34 is impeded by cellular transmembrane protein 140.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...