Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.52
PubTator Score 1.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer -1.651 0.000
lung cancer -3.500 0.000
interstitial cystitis -2.400 0.000
lung adenocarcinoma -2.100 0.000
lung carcinoma -2.900 0.000

Gene RIF (4)

PMID Text
26237329 The study identified two proteins, TMEM79 and ACOXL, with potential to differentiate between benign and cancerous prostatic glands in tissue biopsies.
20731705 Observational study of gene-disease association. (HuGE Navigator)
20332261 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVSRSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGS      1 - 70
PEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMYIGNAMYGNYA     71 - 140
AVFAQLIIDGRSQGPHCFIVPVRDENGSLYPGVTAIDMMYKEGLHGVDNGILIFDKVRIPRENLLDKFGS    141 - 210
VAPDGQYHSPIRNKSARFNAMLAALTPSRLAVAFQAMGAMKLGLTIAIRYSHSRRQFGPKTKEEVKIIEH    211 - 280
QTQTLRLMPHLATALALTFVSRYAGALLDEDVFQGKELVNSRSLQALVAGLKAYSTWENIRCLQDCRECT    281 - 350
GGMGYMMENRISGLKCDTDVFATFEGDDVVMLQVVGRELLAQYTKQYEEKPLFGLLQNWAESVGDKLRTS    351 - 420
FLAFNMDTVDDLAFLLKAVKFRERVLQRGLVARIYYKVKTKKEDFFHAWNSCLHHVASLSLAHTHRVTLE    421 - 490
QFSLAVKSCPDQEDQTLLMKFCLLYGTKLVFQERAWYLEHKYLTPMASTRIRNQERC                 491 - 547
//

Text Mined References (20)

PMID Year Title
26237329 2015 Analysis of the Human Prostate-Specific Proteome Defined by Transcriptomics and Antibody-Based Profiling Identifies TMEM79 and ACOXL as Two Putative, Diagnostic Markers in Prostate Cancer.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22700719 2012 Common variation at 6p21.31 (BAK1) influences the risk of chronic lymphocytic leukemia.
22566634 2012 The genetic architecture of economic and political preferences.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22197929 2011 A genome-wide association study in Han Chinese identifies multiple susceptibility loci for IgA nephropathy.
More...