Property Summary

NCBI Gene PubMed Count 103
PubMed Score 59.91
PubTator Score 151.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.300 5.3e-12
group 3 medulloblastoma 1.300 5.9e-04
lung cancer 1.800 3.8e-05
ovarian cancer 1.300 3.6e-03
Pick disease -1.100 5.7e-04
progressive supranuclear palsy -1.200 2.3e-02

Protein-protein Interaction (2)

Gene RIF (77)

AA Sequence

MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALP      1 - 70
IIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWA     71 - 140
STHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHI    141 - 210
HRLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPE    211 - 280
SNSDVDQLKKDLESANLTANQHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATILTDHQYLERTPLCA    281 - 350
ILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYD    351 - 420
SKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSA    421 - 490
PFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLM    491 - 560
DSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVA    561 - 630
EDVI                                                                      631 - 634
//

Text Mined References (108)

PMID Year Title