Property Summary

Ligand Count 782
NCBI Gene PubMed Count 62
PubMed Score 139.39
PubTator Score 90.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.0e-07
Breast cancer 1.100 9.6e-06
cutaneous lupus erythematosus 1.300 5.8e-04
group 3 medulloblastoma 1.200 3.8e-04
lung cancer 1.200 3.3e-03
medulloblastoma, large-cell 1.300 5.7e-06
non-small cell lung cancer 1.136 4.6e-15
osteosarcoma -1.005 8.5e-05
psoriasis 1.300 7.9e-04
tuberculosis -1.100 7.1e-05

Gene RIF (48)

AA Sequence

MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDS      1 - 70
VLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKE     71 - 140
EEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDW    141 - 210
LVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIH    211 - 280
TSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSET    281 - 350
NVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESM    351 - 420
LTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNA    421 - 490
MPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFF    491 - 560
AGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS                          561 - 608
//

Text Mined References (66)

PMID Year Title