Property Summary

NCBI Gene PubMed Count 58
Grant Count 73
R01 Count 33
Funding $6,902,530.66
PubMed Score 126.53
PubTator Score 90.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 0.001
psoriasis 1.300 0.001
osteosarcoma -1.005 0.000
group 3 medulloblastoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.300 0.000
tuberculosis and treatment for 3 months -1.300 0.000
non-small cell lung cancer 1.136 0.000
lung cancer 2.900 0.000
Breast cancer 1.100 0.000

Gene

PANTHER Protein Class (2)

PDB

1JY1   1MU7   1MU9   1NOP   1QZQ   1RFF   1RFI   1RG1   1RG2   1RGT   1RGU   1RH0  

Gene RIF (45)

PMID Text
26421495 Tyrosyl-DNA-phosphodiesterase I (TDP1) participates in the removal and repair of stabilized-Top2alpha cleavage complexes in human cells.
26181362 The data obtained suggest that PARP1 and TDP1 bind in an antiparallel orientation; the N-terminus of the former protein interacts with the C-terminal domain of the latter.
26121557 Density functional theory computations are used to acquire thermodynamic and kinetic data along the catalytic pathway, including the phosphoryl transfers of Tdp1 and subsequent hydrolysis.
25987486 both TOP1 and TDP1 were upregulated in the tumor tissue compared to the adjacent non-tumor tissue in non-small cell lung cancer tissue
25841101 TDP1 plays a role during the early stages of mammalian NHEJ. TPD1 stimulated DNA binding by XLF. TDP1 also promoted DNA binding by Ku70/80 and stimulated DNA-PK activity.
25609251 These findings suggest that the flexibility of Tdp1 active site residues may impair the resolution of mutant Tdp1 covalent phosphohistidyl intermediates
25522766 varying expression levels of TOP1 and TDP1 polypeptides in multiple colorectal cancer cell lines and in clinical colorectal cancer samples, are reported.
24856239 This article summarizes and compares the biochemistry, functions, and post-translational regulation of TDP1 and TDP2, as well as the relevance of TDP1 and TDP2 as determinants of response to anticancer agents
24355542 Data provides insights into the possible inactivation of TDP1 in cancers and its relationship to cellular response to Top1-targeted drugs.
24335147 TDP1 deficiency sensitizes human cells to base damage, independently of apurinic/apyrimidinic endonuclease I (APE1).
More...

AA Sequence

MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDS      1 - 70
VLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKE     71 - 140
EEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDW    141 - 210
LVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIH    211 - 280
TSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSET    281 - 350
NVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESM    351 - 420
LTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNA    421 - 490
MPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFF    491 - 560
AGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS                          561 - 608
//

Text Mined References (62)

PMID Year Title
26421495 2015 Tyrosyl-DNA-phosphodiesterase I (TDP1) participates in the removal and repair of stabilized-Top2? cleavage complexes in human cells.
26181362 2015 Poly(ADP-ribose)polymerase 1 stimulates the AP-site cleavage activity of tyrosyl-DNA phosphodiesterase 1.
26121557 2015 A Theoretical Study of Phosphoryl Transfers of Tyrosyl-DNA Phosphodiesterase I (Tdp1) and the Possibility of a "Dead-End" Phosphohistidine Intermediate.
25987486 2015 Correlation between topoisomerase I and tyrosyl-DNA phosphodiesterase 1 activities in non-small cell lung cancer tissue.
25841101 2015 TDP1 promotes assembly of non-homologous end joining protein complexes on DNA.
25609251 2015 Tyrosyl-DNA phosphodiesterase I catalytic mutants reveal an alternative nucleophile that can catalyze substrate cleavage.
25522766 2015 Clinical and cellular roles for TDP1 and TOP1 in modulating colorectal cancer response to irinotecan.
24856239 2014 Tyrosyl-DNA-phosphodiesterases (TDP1 and TDP2).
24355542 2014 Epigenetic and genetic inactivation of tyrosyl-DNA-phosphodiesterase 1 (TDP1) in human lung cancer cells from the NCI-60 panel.
24335147 2014 TDP1 deficiency sensitizes human cells to base damage via distinct topoisomerase I and PARP mechanisms with potential applications for cancer therapy.
More...