Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.17
PubTator Score 5.54

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25287446 GIMAP4 regulates secretion of cytokines in early differentiating human CD4(+) T helper lymphocytes and in particular the secretion of interferon-gamma also affecting its downstream targets.
23041938 Genome-wide association study identifies GIMAP as a novel susceptibility locus for Behcet's disease
20237496 Observational study of gene-disease association. (HuGE Navigator)
18701445 GIMAP1 and GIMAP4 genes are up-regulated by IL-12 and other Th1 differentiation-inducing cytokines in cells induced to differentiate toward Th1 lineage and down-regulated by IL-4 in cells induced to Th2.
11964296 molecular and genetic properties; expression in resting T- and B-cells and decreased expression during lymphocyte activation

AA Sequence

MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCE      1 - 70
KRSSSWKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLVVPLGRYTEEEHKATEKILKM     71 - 140
FGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQ    141 - 210
RVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQME    211 - 280
KKLAEQEAHYAVRQQRARTEVESKDGILELIMTALQIASFILLRLFAED                         281 - 329
//

Text Mined References (18)

PMID Year Title
25287446 2015 Tubulin- and actin-associating GIMAP4 is required for IFN-? secretion during Th cell differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
23041938 2013 Genome-wide association study identifies GIMAP as a novel susceptibility locus for Behcet's disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18701445 2009 Quantitative proteomics reveals GIMAP family proteins 1 and 4 to be differentially regulated during human T helper cell differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16509771 2006 IAN family critically regulates survival and development of T lymphocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...