Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.00
PubTator Score 5.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (5)

AA Sequence

MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCE      1 - 70
KRSSSWKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLVVPLGRYTEEEHKATEKILKM     71 - 140
FGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQ    141 - 210
RVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQME    211 - 280
KKLAEQEAHYAVRQQRARTEVESKDGILELIMTALQIASFILLRLFAED                         281 - 329
//

Text Mined References (18)

PMID Year Title