Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.46
PubTator Score 7.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -2.300 3.3e-02
adult high grade glioma 1.200 9.5e-04
Atopic dermatitis -1.100 4.6e-03
cystic fibrosis 1.547 7.1e-06
facioscapulohumeral dystrophy -2.100 4.4e-03
interstitial cystitis -1.300 5.9e-03
lung carcinoma -2.400 3.3e-26
osteosarcoma -1.110 1.6e-03
ovarian cancer -2.800 7.5e-08
pancreatic ductal adenocarcinoma liver m... -1.007 1.4e-02
pituitary cancer -1.100 1.8e-03
posterior fossa group A ependymoma 1.100 1.1e-07
psoriasis -1.400 2.3e-03
urothelial carcinoma -1.400 2.5e-02

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEAPLHVMVFTYMGY      1 - 70
GIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSAPGPLFDL     71 - 140
MERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKE    141 - 210
LEDLVAKFLNVEAAMVFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGATIRIFKHNNTQSL    211 - 280
EKLLRDAVIYGQPRTRRAWKKILILVEGVYSMEGSIVHLPQIIALKKKYKAYLYIDEAHSIGAVGPTGRG    281 - 350
VTEFFGLDPHEVDVLMGTFTKSFGASGGYIAGRKDLVDYLRVHSHSAVYASSMSPPIAEQIIRSLKLIMG    351 - 420
LDGTTQGLQRVQQLAKNTRYFRQRLQEMGFIIYGNENASVVPLLLYMPGKVAAFARHMLEKKIGVVVVGF    421 - 490
PATPLAEARARFCVSAAHTREMLDTVLEALDEMGDLLQLKYSRHKKSARPELYDETSFELED            491 - 552
//

Text Mined References (23)

PMID Year Title