Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.36
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease -1.600 0.005
malignant mesothelioma -4.700 0.000
cutaneous lupus erythematosus 1.200 0.033
osteosarcoma -2.280 0.000
non-small cell lung cancer -1.798 0.000
lung cancer -3.000 0.000
lung adenocarcinoma -1.900 0.000
ovarian cancer -1.100 0.001
pituitary cancer -1.100 0.001

Synonym

Accession Q9NUU6 Q53H50 Q9H037
Symbols NET20

Gene

 Compartment GO Term (0)

AA Sequence

MAATRSPTRARERERSGAPAAGSDQVHSWMLATSQALDTVWRMAKGFVMLAVSFLVAAICYFRRLHLYSG      1 - 70
HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEELFWRHHIKCVRQVRRDNYDA     71 - 140
LRSVLFQIFSQGISFPSWMKEKDIVKLPEKLLFSQGCNWIQQYSFGPEKYTGSNVFGKLRKYVELLKTQW    141 - 210
TEFNGIRDYHKRGSMCNTLFSDAILEYKLYEALKFIMLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDP    211 - 280
LSFMMNHLNSVGDTCGLEQIDMFILGYSLEVKIKVFRLFKFNSRDFEVCYPEEPLRDWPEISLLTENDRH    281 - 350
YHIPVF                                                                    351 - 356
//

Text Mined References (9)

PMID Year Title
23708998 2013 The linear ubiquitin-specific deubiquitinase gumby regulates angiogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.