Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.48
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 3.3e-02
interstitial lung disease -1.300 7.1e-03
lung adenocarcinoma -1.400 4.7e-12
lung cancer -1.700 5.5e-03
malignant mesothelioma -4.300 7.3e-10
non-small cell lung cancer -1.798 9.8e-16
osteosarcoma -2.185 3.6e-04
ovarian cancer -1.100 7.7e-04
pituitary cancer -1.100 6.8e-04

AA Sequence

MAATRSPTRARERERSGAPAAGSDQVHSWMLATSQALDTVWRMAKGFVMLAVSFLVAAICYFRRLHLYSG      1 - 70
HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEELFWRHHIKCVRQVRRDNYDA     71 - 140
LRSVLFQIFSQGISFPSWMKEKDIVKLPEKLLFSQGCNWIQQYSFGPEKYTGSNVFGKLRKYVELLKTQW    141 - 210
TEFNGIRDYHKRGSMCNTLFSDAILEYKLYEALKFIMLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDP    211 - 280
LSFMMNHLNSVGDTCGLEQIDMFILGYSLEVKIKVFRLFKFNSRDFEVCYPEEPLRDWPEISLLTENDRH    281 - 350
YHIPVF                                                                    351 - 356
//

Text Mined References (9)

PMID Year Title