Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 30.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 7.5e-05
group 4 medulloblastoma 1855 8.1e-05

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.100 8.1e-05
medulloblastoma, large-cell -1.100 7.5e-05

AA Sequence

MVHAFLIHTLRAPNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQVESMCRLQQQ      1 - 70
ASGRPPMDLQPQSSDEQVPLHEAPRGAFRLAAENPFQEPRTVVWLGVLSLGFALVLDAHENLLLAEGTLR     71 - 140
LLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAWPR              141 - 200
//

Text Mined References (7)

PMID Year Title