Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.93
PubTator Score 9.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma 1.300 2.0e-03
Astrocytoma, Pilocytic 2.800 5.0e-10
atypical teratoid / rhabdoid tumor -1.400 1.5e-05
Breast cancer 2.300 2.7e-02
Chronic Lymphocytic Leukemia 2.505 6.5e-09
cystic fibrosis -1.155 1.3e-04
dermatomyositis 1.100 1.1e-02
diabetes mellitus -1.100 2.1e-03
ductal carcinoma in situ -1.500 1.9e-03
glioblastoma 1.200 2.6e-03
intraductal papillary-mucinous adenoma (... 1.800 4.4e-03
intraductal papillary-mucinous carcinoma... 1.400 2.2e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.8e-02
invasive ductal carcinoma -1.600 3.4e-03
juvenile dermatomyositis 1.263 5.3e-10
lung carcinoma -2.100 3.7e-34
medulloblastoma, large-cell -1.700 4.0e-02
Multiple myeloma 1.484 3.3e-03
osteosarcoma 1.312 4.7e-03
ovarian cancer -2.900 1.1e-08
pancreatic cancer 1.200 3.9e-03
pituitary cancer -1.200 1.6e-02
primary pancreatic ductal adenocarcinoma 1.116 1.0e-02
psoriasis -1.700 3.3e-04
sonic hedgehog group medulloblastoma -1.200 6.0e-03
subependymal giant cell astrocytoma 1.538 1.5e-02
Systemic lupus erythematosus 1.500 9.4e-04

Gene RIF (7)

AA Sequence

MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWNMTGKKKNNKR      1 - 70
KRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDSANEKPALIPREKKISILEEP     71 - 140
SKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWSAEQPCNPSKPKAKTSPVKSNTPAAHLEIKP    141 - 210
DELAKKRGPNIEKSVKDLQRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKE    211 - 280
EAMEILTARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCDIEQLKAQIML    281 - 350
CGEITHPKNNYSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQ    351 - 420
TMPANKQNGSSNQRRRFNPQYHNNRLNGPAKSQGSGNEAEPLGKGNSRHEHRRQPHNGFRPKNKGGAKNQ    421 - 490
EASLGMKTPEAPAHSEKPRRRQHAADTSEARPFRGSVGRVSQCNLCPTRIEVSTDAAVLSVPAVTLVA      491 - 558
//

Text Mined References (28)

PMID Year Title