Property Summary

NCBI Gene PubMed Count 23
PubMed Score 10.55
PubTator Score 6.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
aldosterone-producing adenoma -1.256 3.1e-02
group 4 medulloblastoma 2.400 2.2e-04
medulloblastoma, large-cell 1.500 9.8e-04
Multiple myeloma 1.138 8.7e-04
ovarian cancer -1.200 1.3e-05
progressive supranuclear palsy -1.100 3.3e-02
psoriasis 1.200 8.3e-03
subependymal giant cell astrocytoma -1.168 1.8e-02

Gene RIF (10)

AA Sequence

MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVR      1 - 70
ANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQL     71 - 140
LSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT                 141 - 197
//

Text Mined References (28)

PMID Year Title