Property Summary

NCBI Gene PubMed Count 23
Grant Count 10
R01 Count 10
Funding $384,108.08
PubMed Score 10.46
PubTator Score 6.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.138 0.001
psoriasis 1.200 0.008
group 4 medulloblastoma 2.400 0.000
medulloblastoma, large-cell 1.500 0.001
aldosterone-producing adenoma -1.256 0.031
subependymal giant cell astrocytoma -1.168 0.018
progressive supranuclear palsy -1.100 0.033
ovarian cancer -1.200 0.000

Gene RIF (10)

PMID Text
24961284 Data show that mirtazapine caused substantial up-regulation of the Lin-7C/beta-catenin pathway in a metastatic squamous cell carcinomas (hSCCs) cell line and melanoma-derived cell line.
20702775 The Dlg1-MPP7-Mals3 heterotrimer consists of 2 pairs of heterodimeric L27 domains. These 2 dimers are asymmetric due to the large difference between the N- and C-terminal tandem L27 domain of MPP7.
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18854154 Knockdown of lin-7 homolog C (C. elegans, LIN7C) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18543122 Observational study of gene-disease association. (HuGE Navigator)
18286632 Allelic and haplotype association was found between both BDNF and adult ADHD, and LIN-7 and adult ADHD.
18286632 Observational study of gene-disease association. (HuGE Navigator)
17942893 Overexpression of the Lin-7C gene in an OSCC cell clone does not contribute to underproliferation but results in a noninvasive phenotype with elevated beta-catenin expression.
17237226 LIN7C is a PDZ protein that interacts with human papillomavirus-16 E6 and forms a tripartite complex with MPP7 and DLG1, regulating the stability and localization of DLG1 to cell junctions.
16147993 analysis of the solution structure of the heterodimer composed of the L27 domains from LIN-2 and LIN-7

AA Sequence

MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVR      1 - 70
ANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQL     71 - 140
LSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT                 141 - 197
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24961284 2014 Suppression of metastasis by mirtazapine via restoration of the Lin-7C/?-catenin pathway in human cancer cells.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23201090 2013 miR-199a-5p regulates urothelial permeability and may play a role in bladder pain syndrome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21269460 2011 Initial characterization of the human central proteome.
20702775 2010 Structural basis for tandem L27 domain-mediated polymerization.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
More...