Property Summary

NCBI Gene PubMed Count 20
PubMed Score 126.11
PubTator Score 16.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
inflammatory breast cancer -1.100 8.0e-04
intraductal papillary-mucinous carcinoma... -1.100 1.2e-02
lung adenocarcinoma -1.100 1.5e-08
medulloblastoma, large-cell -1.700 2.8e-06
Multiple myeloma 1.621 1.0e-03
ovarian cancer -2.600 2.2e-10
pancreatic ductal adenocarcinoma liver m... -2.317 7.2e-03

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MATSGAASAELVIGWCIFGLLLLAILAFCWIYVRKYQSRRESEVVSTITAIFSLAIALITSALLPVDIFL      1 - 70
VSYMKNQNGTFKDWANANVSRQIEDTVLYGYYTLYSVILFCVFFWIPFVYFYYEEKDDDDTSKCTQIKTA     71 - 140
LKYTLGFVVICALLLLVGAFVPLNVPNNKNSTEWEKVKSLFEELGSSHGLAALSFSISSLTLIGMLAAIT    141 - 210
YTAYGMSALPLNLIKGTRSAAYERLENTEDIEEVEQHIQTIKSKSKDGRPLPARDKRALKQFEERLRTLK    211 - 280
KRERHLEFIENSWWTKFCGALRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSN    281 - 350
PLNMLLPLLQTVFPLDYILITIIIMYFIFTSMAGIRNIGIWFFWIRLYKIRRGRTRPQALLFLCMILLLI    351 - 420
VLHTSYMIYSLAPQYVMYGSQNYLIETNITSDNHKGNSTLSVPKRCDADAPEDQCTVTRTYLFLHKFWFF    421 - 490
SAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDISDDEPSVYSA                        491 - 540
//

Text Mined References (22)

PMID Year Title