Property Summary

NCBI Gene PubMed Count 48
PubMed Score 36.22
PubTator Score 29.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (34)

AA Sequence

MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRI      1 - 70
PRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDVQKR     71 - 140
TIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYM    141 - 210
YDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ          211 - 274
//

Text Mined References (54)

PMID Year Title