Tbio | Transmembrane protein 106B |
Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching.
Comments
Disease | Target Count |
---|---|
Frontotemporal Lobar Degeneration | 5 |
Disease | Target Count | P-value |
---|---|---|
lung adenocarcinoma | 2714 | 1.3357778357456E-12 |
osteosarcoma | 7933 | 1.50874616794401E-6 |
posterior fossa group A ependymoma | 1511 | 2.82868515247442E-6 |
Pick disease | 1893 | 4.9468009802635E-5 |
pediatric high grade glioma | 2712 | 7.9671229701498E-5 |
glioblastoma | 5572 | 9.9207764315487E-5 |
cystic fibrosis | 1670 | 4.676047301736E-4 |
pilocytic astrocytoma | 3086 | 5.26166839769215E-4 |
ovarian cancer | 8492 | 0.00109957858626985 |
Multiple myeloma | 1328 | 0.0017902506411296 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 0.00498622374024971 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00779242438852812 |
acute quadriplegic myopathy | 1157 | 0.0103898161112099 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 0.0122443473409825 |
non primary Sjogren syndrome sicca | 840 | 0.0214433348472217 |
spina bifida | 1064 | 0.045046261339187 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Neurodegenerative disease | 383 | 3.305 | 1.7 |
Amyotrophic Lateral Sclerosis | 432 | 0.0 | 4.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Frontotemporal dementia | 47 | 5.766 | 2.9 |
Disease | log2 FC | p |
---|---|---|
Multiple myeloma | 1.496 | 0.002 |
osteosarcoma | 3.102 | 0.000 |
glioblastoma | 1.100 | 0.000 |
cystic fibrosis | 1.497 | 0.000 |
Amyotrophic Lateral Sclerosis | 1.129 | 0.001 |
acute quadriplegic myopathy | 1.096 | 0.010 |
intraductal papillary-mucinous adenoma (... | 1.400 | 0.005 |
intraductal papillary-mucinous carcinoma... | 1.400 | 0.012 |
intraductal papillary-mucinous neoplasm ... | 1.500 | 0.008 |
pediatric high grade glioma | 1.500 | 0.000 |
pilocytic astrocytoma | 1.300 | 0.001 |
posterior fossa group A ependymoma | 1.200 | 0.000 |
non primary Sjogren syndrome sicca | -1.100 | 0.021 |
lung adenocarcinoma | 2.329 | 0.000 |
spina bifida | -2.168 | 0.045 |
Pick disease | 2.000 | 0.000 |
ovarian cancer | 1.800 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26651479 | Endogenous TMEM106B was partly sequestered in CHMP2B-positive structures. The roles of SNPs T185, S185, or S134N in endosomal sorting complexes required for transport were studied. T185 is a risk factor in neurodegeneration with endolysosomal defects. |
25653292 | Common variants in TMEM106B serve as a distinct risk factor for TDP-43 pathology in older persons without frontotemporal lobe dementia. |
25470345 | This study confirmed that specific TMEM106B single-nucleotide polymorphisms is associated with HS-Aging pathology in the Alzheimer disease. |
25114081 | TMEM106b variability does not influence Alzheimer disease risk or plasma progranulin levels. |
25096617 | Study suggests that TMEM106B is associated with frontotemporal dementia, although the extent of this effect is difficult to be estimated by using clinical frontotemporal dementia series |
25085782 | It is a risk factor for frontotemporal lobar degeneration. |
25066864 | Neuronal TMEM106B plays a central role in regulating lysosomal size, motility and responsiveness to stress, highlighting the possible role of lysosomal biology in FTLD-TDP. |
24899141 | The HpScl groups (Hippocampual Sclerosis and Hippocampual Sclerosis-AD) were more likely to exhibit genetic variants in TMEM106B that are associated with frontotemporal lobar degeneration. |
24872421 | Regulated intramembrane proteolysis of the frontotemporal lobar degeneration risk factor, TMEM106B, by signal peptide peptidase-like 2a (SPPL2a). |
24731779 | results show that, in nondemented persons, TMEM106B influences the volume of temporal brain regions that are important for language processing. |
More... |
MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRI 1 - 70 PRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDVQKR 71 - 140 TIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYM 141 - 210 YDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ 211 - 274 //
PMID | Year | Title |
---|---|---|
26651479 | 2015 | TMEM106B, a frontotemporal lobar dementia (FTLD) modifier, associates with FTD-3-linked CHMP2B, a complex of ESCRT-III. |
25653292 | 2015 | The TMEM106B locus and TDP-43 pathology in older persons without FTLD. |
25470345 | 2015 | Reassessment of risk genotypes (GRN, TMEM106B, and ABCC9 variants) associated with hippocampal sclerosis of aging pathology. |
25255805 | 2014 | Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. |
25114081 | 2015 | Transmembrane protein 106B gene (TMEM106B) variability and influence on progranulin plasma levels in patients with Alzheimer's disease. |
25096617 | 2015 | Association of TMEM106B rs1990622 marker and frontotemporal dementia: evidence for a recessive effect and meta-analysis. |
25085782 | 2014 | Defining the association of TMEM106B variants among frontotemporal lobar degeneration patients with GRN mutations and C9orf72 repeat expansions. |
25066864 | 2014 | Lysosome size, motility and stress response regulated by fronto-temporal dementia modifier TMEM106B. |
24899141 | 2014 | Differential clinicopathologic and genetic features of late-onset amnestic dementias. |
24872421 | 2014 | Regulated intramembrane proteolysis of the frontotemporal lobar degeneration risk factor, TMEM106B, by signal peptide peptidase-like 2a (SPPL2a). |
More... |