1. Home
  2. Targets
  3. Transmembrane protein 106B

Tbio Transmembrane protein 106B

Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching.

 Comments

Property Summary

NCBI Gene PubMed Count 41
PubMed Score 28.46
PubTator Score 29.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Frontotemporal Lobar Degeneration 5
Disease Target Count P-value
lung adenocarcinoma 2714 1.3357778357456E-12
osteosarcoma 7933 1.50874616794401E-6
posterior fossa group A ependymoma 1511 2.82868515247442E-6
Pick disease 1893 4.9468009802635E-5
pediatric high grade glioma 2712 7.9671229701498E-5
glioblastoma 5572 9.9207764315487E-5
cystic fibrosis 1670 4.676047301736E-4
pilocytic astrocytoma 3086 5.26166839769215E-4
ovarian cancer 8492 0.00109957858626985
Multiple myeloma 1328 0.0017902506411296
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00498622374024971
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00779242438852812
acute quadriplegic myopathy 1157 0.0103898161112099
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0122443473409825
non primary Sjogren syndrome sicca 840 0.0214433348472217
spina bifida 1064 0.045046261339187
Disease Target Count Z-score Confidence
Dementia 129 3.637 1.8
Anorexia nervosa 59 0.0 1.0
Disease Target Count Z-score Confidence
Frontotemporal dementia 47 5.766 2.9

Expression

Synonym

Accession Q9NUM4 A4D108 Q53FL9 Q8N4L0
Symbols

Gene

TMEM106B

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Component (5)

 GO Process (5)

 Compartment GO Term (42)

See all...

 IMPC Term (10)

 MGI Term (4)

 GWAS Trait (1)

 HCA RNA Cell Line (56)

See all...

Pathway (1)

 UniProt Keyword (16)

See all...

Gene RIF (27)

PMID Text
26651479 Endogenous TMEM106B was partly sequestered in CHMP2B-positive structures. The roles of SNPs T185, S185, or S134N in endosomal sorting complexes required for transport were studied. T185 is a risk factor in neurodegeneration with endolysosomal defects.
25653292 Common variants in TMEM106B serve as a distinct risk factor for TDP-43 pathology in older persons without frontotemporal lobe dementia.
25470345 This study confirmed that specific TMEM106B single-nucleotide polymorphisms is associated with HS-Aging pathology in the Alzheimer disease.
25114081 TMEM106b variability does not influence Alzheimer disease risk or plasma progranulin levels.
25096617 Study suggests that TMEM106B is associated with frontotemporal dementia, although the extent of this effect is difficult to be estimated by using clinical frontotemporal dementia series
25085782 It is a risk factor for frontotemporal lobar degeneration.
25066864 Neuronal TMEM106B plays a central role in regulating lysosomal size, motility and responsiveness to stress, highlighting the possible role of lysosomal biology in FTLD-TDP.
24899141 The HpScl groups (Hippocampual Sclerosis and Hippocampual Sclerosis-AD) were more likely to exhibit genetic variants in TMEM106B that are associated with frontotemporal lobar degeneration.
24872421 Regulated intramembrane proteolysis of the frontotemporal lobar degeneration risk factor, TMEM106B, by signal peptide peptidase-like 2a (SPPL2a).
24731779 results show that, in nondemented persons, TMEM106B influences the volume of temporal brain regions that are important for language processing.
More...

AA Sequence 

MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRI      1 - 70
PRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDVQKR     71 - 140
TIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYM    141 - 210
YDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ          211 - 274
//

Text Mined References (47)

PMID Year Title
26651479 2015 TMEM106B, a frontotemporal lobar dementia (FTLD) modifier, associates with FTD-3-linked CHMP2B, a complex of ESCRT-III.
25653292 2015 The TMEM106B locus and TDP-43 pathology in older persons without FTLD.
25470345 2015 Reassessment of risk genotypes (GRN, TMEM106B, and ABCC9 variants) associated with hippocampal sclerosis of aging pathology.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25114081 2015 Transmembrane protein 106B gene (TMEM106B) variability and influence on progranulin plasma levels in patients with Alzheimer's disease.
25096617 2015 Association of TMEM106B rs1990622 marker and frontotemporal dementia: evidence for a recessive effect and meta-analysis.
25085782 2014 Defining the association of TMEM106B variants among frontotemporal lobar degeneration patients with GRN mutations and C9orf72 repeat expansions.
25066864 2014 Lysosome size, motility and stress response regulated by fronto-temporal dementia modifier TMEM106B.
24899141 2014 Differential clinicopathologic and genetic features of late-onset amnestic dementias.
24872421 2014 Regulated intramembrane proteolysis of the frontotemporal lobar degeneration risk factor, TMEM106B, by signal peptide peptidase-like 2a (SPPL2a).
More...